BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120849.seq (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 1.9 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 3.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 3.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 3.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 3.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 3.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 3.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 3.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 3.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.3 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 7.6 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 7.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 7.6 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 1.9 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = +3 Query: 90 MGVLKIIIDTVIKYIGK 140 MG++++I+ TV KY+G+ Sbjct: 146 MGIVELIMFTVNKYVGE 162 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 62 KRRRGWRTQHGRFKDHHR 115 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.6 bits (46), Expect = 3.3 Identities = 16/60 (26%), Positives = 24/60 (40%) Frame = +2 Query: 272 SGQSVDVCNELKYPWNLITANSFIVSTDESRQSQYIYRTFLLYNTVLTAILKQNNPFNVI 451 SG +CN +KY N S I + ++ YR ++N L + NP I Sbjct: 147 SGMFEALCNHIKYSTNKGNIRSAITIFPQRTDGKHDYR---VWNHQLISYAGYKNPDGTI 203 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 107 HHRYGHQVHWQTGRRR 154 +H G HW +GRR+ Sbjct: 261 NHLSGGTNHWDSGRRK 276 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 440 MDCFV*ELRSKLYCTKEKCDK 378 +DC + K KEKCD+ Sbjct: 361 LDCHTAHIACKFADIKEKCDR 381 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 36 KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKY 131 +PI + +RSVDE L ++ + KY Sbjct: 1152 EPILADMWRSVDEMEVRKTSALTTVLTGLRKY 1183 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 7.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 36 KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKY 131 +PI + +RSVDE L ++ + KY Sbjct: 1148 EPILADMWRSVDEMEVRKTSALTTVLTGLRKY 1179 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,046 Number of Sequences: 438 Number of extensions: 4117 Number of successful extensions: 34 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -