BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120848.seq (612 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharom... 28 1.2 >SPBC2D10.09 |||3-hydroxyisobutyryl-CoA hydrolase|Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 27.9 bits (59), Expect = 1.2 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 575 NFLLKNMXFXMXSGILNNPIWVSLSSNIYIMY-SRNRTRNLSALRSK 438 NFL N M + NP + S SSN ++Y S+N R + R K Sbjct: 29 NFLSLNASSTMSRAFIRNPKFYSTSSNDTVLYESKNGARIFTLNRPK 75 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,012,835 Number of Sequences: 5004 Number of extensions: 33587 Number of successful extensions: 76 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -