BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120848.seq (612 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) 28 6.9 SB_40049| Best HMM Match : LRR_1 (HMM E-Value=0.082) 28 6.9 >SB_57009| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 564 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = -1 Query: 195 YLMTTLVSDXVIYK--TSHVYVVQTNFVNIT*NYGYGKTRRHRLHFLI 58 Y ++ L D + + T H Y +T+++ T G G TRRH +F++ Sbjct: 171 YALSDLQGDYLQLRDPTCHAYENKTHYIFKTPLTGCGTTRRHTKNFIV 218 >SB_40049| Best HMM Match : LRR_1 (HMM E-Value=0.082) Length = 380 Score = 27.9 bits (59), Expect = 6.9 Identities = 9/27 (33%), Positives = 21/27 (77%), Gaps = 1/27 (3%) Frame = +1 Query: 67 MQSMSPRFTIA-IILGYIDEISLDYVN 144 +QS++P F + +++ Y+DE++ D++N Sbjct: 185 LQSLAPCFQLKKLVISYLDEVTHDFIN 211 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,124,674 Number of Sequences: 59808 Number of extensions: 224182 Number of successful extensions: 256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 256 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1499981500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -