BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120845.seq (692 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces ... 26 4.5 SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subun... 26 4.5 SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|... 26 5.9 >SPCC74.06 |mak3|phk2|histidine kinase Mak3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 2344 Score = 26.2 bits (55), Expect = 4.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 468 EVFTSGTQRLYTALRNYKKHSRHHKPEHV 554 E++TS TQ L A+RNY K H+ Sbjct: 1354 ELYTSATQYLEEAIRNYAALGVKQKARHL 1382 >SPAC4G9.08c |rpc2||DNA-directed RNA polymerase III complex subunit Rpc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1165 Score = 26.2 bits (55), Expect = 4.5 Identities = 9/38 (23%), Positives = 17/38 (44%) Frame = +1 Query: 64 MPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPXAY 177 +P+G P +R N+C+ + + + P P Y Sbjct: 155 VPIGRMPVMLRSNKCVLSGKNEMEMAALNECPLDPGGY 192 >SPCC11E10.04 |||mitochondrial ATPase expression protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 443 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 3/32 (9%) Frame = -2 Query: 532 LECFL*LRNAVYNRCVPLVK---TSVYFRLXH 446 +E F+ L + +Y CVP+++ TS+ F + H Sbjct: 333 IELFIRLYSQMYRHCVPIIEIYDTSIKFYMKH 364 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,822,434 Number of Sequences: 5004 Number of extensions: 54873 Number of successful extensions: 127 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -