BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120843.seq (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38846| Best HMM Match : Cache (HMM E-Value=2.7e-09) 31 1.2 SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_38846| Best HMM Match : Cache (HMM E-Value=2.7e-09) Length = 916 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +1 Query: 7 SRIDKNYYDSVKPISSVTLCCVTTSDLIPYKKK 105 S +D NY DS P+S+V++C V L+ ++K Sbjct: 705 STLDFNYCDSEYPLSNVSICAVPAEALLTSEEK 737 >SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1529 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -3 Query: 128 VGGISHTYFFLYGMRSEVVTQHSVTELIGLTES 30 V G ++F+LYG+ ++T H E+I T+S Sbjct: 1180 VWGCERSHFYLYGVEFVLLTDHKPLEVIYSTKS 1212 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,944,621 Number of Sequences: 59808 Number of extensions: 460351 Number of successful extensions: 899 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 820 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 898 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -