BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120843.seq (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 25 1.7 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 24 5.2 AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-b... 23 6.8 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 23 6.8 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 23 9.0 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -3 Query: 656 RFTATXFNTTCPVIIXRNKGPRXECPYDRLIKNIAFYDIGNND 528 +FT T N I+ R+ PY+R +N+A + N+ Sbjct: 533 KFTVT-LNAGANTIVRRSDQSSVSIPYERTFRNVAASSLTQNE 574 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 617 IIXRNKGPRXECPYDRLIKNIAFYDIGN 534 II R+ PY+R +N+A +IG+ Sbjct: 557 IIRRSANSSVTIPYERTFRNVANTNIGD 584 >AJ697726-1|CAG26919.1| 198|Anopheles gambiae putative odorant-binding protein OBPjj16 protein. Length = 198 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 184 VRPLSSMDYKFCCGFFPQQFCN 249 V P+SS + C F PQ F N Sbjct: 133 VAPISSSPDRAGCSFIPQGFVN 154 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 172 RIVRVRPLSSMDYKFCCGFFPQ 237 R+ RVRPL+S+ G+FP+ Sbjct: 253 RLSRVRPLTSLREPLPEGYFPK 274 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.0 bits (47), Expect = 9.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 172 RIVRVRPLSSMDYKFCCGFFPQ 237 R+ RVRPL+++ G+FP+ Sbjct: 252 RLARVRPLTNLREPLPEGYFPK 273 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 746,260 Number of Sequences: 2352 Number of extensions: 14196 Number of successful extensions: 45 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -