BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120843.seq (688 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42834-4|AAA83584.1| 2229|Caenorhabditis elegans Hypothetical pr... 30 1.8 AL132948-35|CAC51060.2| 887|Caenorhabditis elegans Hypothetical... 29 3.1 >U42834-4|AAA83584.1| 2229|Caenorhabditis elegans Hypothetical protein F28B4.3 protein. Length = 2229 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 593 RXECPYDRLIKNIAFYDIGNNDIPHKTTNLTNISEN 486 R C Y +++ IGNNDI H + +S+N Sbjct: 277 RFNCTYPYILERYTCRKIGNNDIGHNLLQVEGMSDN 312 >AL132948-35|CAC51060.2| 887|Caenorhabditis elegans Hypothetical protein Y39B6A.47 protein. Length = 887 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -3 Query: 317 NTKTNTSGRTCGXFPRLILKPEMLQNCCGKKPQQNL 210 N T RTC FP KP +L +P+ N+ Sbjct: 413 NLNTTAGARTCVIFPIFAPKPNLLPTALSVRPRTNI 448 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,151,242 Number of Sequences: 27780 Number of extensions: 339539 Number of successful extensions: 676 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 663 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 676 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -