BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120836.seq (600 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 23 2.0 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 23 2.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.6 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 22 3.4 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 6.0 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 473 LLENVRVFLYVRIFCCIRNIDVALYSLI 556 +L VFL +F C + I +YSLI Sbjct: 7 VLTAAAVFLLFYLFYCYKTIKQHIYSLI 34 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.0 bits (47), Expect = 2.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 473 LLENVRVFLYVRIFCCIRNIDVALYSLI 556 +L VFL +F C + I +YSLI Sbjct: 7 VLTAAAVFLLFYLFYCYKTIKQHIYSLI 34 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 16 SGP*ATAQKSETSFSFGQQPHTR 84 SGP +T KS F + PH++ Sbjct: 1118 SGPGSTGSKSPPVAGFEESPHSK 1140 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 22.2 bits (45), Expect = 3.4 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +1 Query: 406 TYVYTIAIITRRNNSIIAKCI-LLIGECPSIFVRT 507 T+ ++T SI+ K LLIG C SI+V T Sbjct: 56 TFFALSELLTDLATSILLKVSSLLIGFCASIYVGT 90 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 6.0 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -2 Query: 293 HECHKTLTPCSTHAIAI 243 H CH L C T + A+ Sbjct: 347 HRCHGNLQSCPTRSHAV 363 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,482 Number of Sequences: 336 Number of extensions: 3215 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15143945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -