BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120836.seq (600 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF311904-1|AAM94900.1| 683|Homo sapiens membrane protein SB87 p... 30 7.1 AF258571-1|AAG23774.1| 328|Homo sapiens PP3999 protein. 30 7.1 >AF311904-1|AAM94900.1| 683|Homo sapiens membrane protein SB87 precursor protein. Length = 683 Score = 29.9 bits (64), Expect = 7.1 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 140 PARISFSCSWPSSPRILTIV-SSSNNWQLANPSRHRLQSRVWSTAS 274 P + + W +S I+TI S S +W A+ RH+ +SR STAS Sbjct: 502 PGAVITTSFWHNSSTIMTIQRSKSKDWAPAS-DRHQTRSRASSTAS 546 >AF258571-1|AAG23774.1| 328|Homo sapiens PP3999 protein. Length = 328 Score = 29.9 bits (64), Expect = 7.1 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 140 PARISFSCSWPSSPRILTIV-SSSNNWQLANPSRHRLQSRVWSTAS 274 P + + W +S I+TI S S +W A+ RH+ +SR STAS Sbjct: 147 PGAVITTSFWHNSSTIMTIQRSKSKDWAPAS-DRHQTRSRASSTAS 191 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,758,683 Number of Sequences: 237096 Number of extensions: 1688519 Number of successful extensions: 3578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3578 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -