Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120835.seq
         (416 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc ...    30   3.6  

>U47742-1|AAC50662.1| 2004|Homo sapiens monocytic leukaemia zinc
            finger protein protein.
          Length = 2004

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = -2

Query: 313  DFVTVESQTRAGDEIASFLRTVGCVECLAVNSSVXCNFGGLSMNGSWIFCMCEV 152
            D  ++ES T   +  +S+  T+G   C   +S   C++GGLS + S     C V
Sbjct: 1552 DLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVV 1605


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 51,442,545
Number of Sequences: 237096
Number of extensions: 919351
Number of successful extensions: 3167
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3167
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3144905170
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)