BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120830.seq (660 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical p... 30 1.7 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 28 6.8 U23514-3|AAC46542.2| 421|Caenorhabditis elegans Hypothetical pr... 27 8.9 U23514-2|AAM48532.1| 418|Caenorhabditis elegans Hypothetical pr... 27 8.9 >Z77661-11|CAB01190.2| 1099|Caenorhabditis elegans Hypothetical protein F40G12.3 protein. Length = 1099 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 350 SAISVTSFNFTHIR*IPSSCKILIPYSSSMAFTNLVDTLANTIHRDAITASPSETAISN 526 S I+ T+ NFT I S P S+S + + +++ H A+T+S +A+++ Sbjct: 839 STITATTINFTGTSEISSELTPTSPGSASKTTSGMAKRASSSKHPSAVTSSARSSAVTS 897 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 27.9 bits (59), Expect = 6.8 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +1 Query: 175 HKLQLLPISGKFQAHDINNQQSQLVPGSALS-MAFTNLVDTLANTIHRDAITAPLVETAI 351 HK +LPIS K Q ++N + Q++ L+ + N+ LAN I L+ + Sbjct: 2297 HKYYILPISAKNQI-SLDNLEKQILSVIPLTDVPICNIASALANNRSHFTIRNALIVSNS 2355 Query: 352 SNFCHKLQLYPYQVNSK 402 K++ P++V K Sbjct: 2356 GIVNSKMEGKPHRVAKK 2372 >U23514-3|AAC46542.2| 421|Caenorhabditis elegans Hypothetical protein F48E8.7a protein. Length = 421 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +1 Query: 133 ITAPLVETAISNFRHKLQLLPISGKFQAHDINNQQSQLVPGSALSMAFTNLVDTL 297 +T P+V I + KL+ L +SG + INN+ +++ + + +L D + Sbjct: 269 LTQPIVTVIIHSIGEKLKKLNLSGTVRNFGINNKHIEILAAKSNYVTDLDLSDNV 323 >U23514-2|AAM48532.1| 418|Caenorhabditis elegans Hypothetical protein F48E8.7b protein. Length = 418 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +1 Query: 133 ITAPLVETAISNFRHKLQLLPISGKFQAHDINNQQSQLVPGSALSMAFTNLVDTL 297 +T P+V I + KL+ L +SG + INN+ +++ + + +L D + Sbjct: 266 LTQPIVTVIIHSIGEKLKKLNLSGTVRNFGINNKHIEILAAKSNYVTDLDLSDNV 320 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,654,811 Number of Sequences: 27780 Number of extensions: 272615 Number of successful extensions: 506 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -