BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120829.seq (668 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P41444 Cluster: Fibroblast growth factor homolog precur... 41 0.024 >UniRef50_P41444 Cluster: Fibroblast growth factor homolog precursor; n=4; Nucleopolyhedrovirus|Rep: Fibroblast growth factor homolog precursor - Autographa californica nuclear polyhedrosis virus (AcMNPV) Length = 181 Score = 41.1 bits (92), Expect = 0.024 Identities = 21/35 (60%), Positives = 23/35 (65%) Frame = +3 Query: 543 MYXXXXXXXXXSMADCSALLTHITGHGLFPGRLFI 647 MY SMADCSALLTHITG + PG+LFI Sbjct: 1 MYRLLALVALASMADCSALLTHITGTSI-PGQLFI 34 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,968,264 Number of Sequences: 1657284 Number of extensions: 10355830 Number of successful extensions: 16267 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 15526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16257 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51239674196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -