BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120829.seq (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 22 5.2 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 6.9 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 6.9 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 6.9 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 21 9.1 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.8 bits (44), Expect = 5.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +2 Query: 299 FTSKILLVTQDRWMMSFICAKLMSFFAHDYKHNQIMTHLF 418 F+ + LL+ R + S C+K +S Y N HLF Sbjct: 471 FSVEHLLMELSRAIDSVACSKTVSDGIRHYYVNVTFPHLF 510 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = +1 Query: 394 QSNNDSFVFQN*TRFTSKILLVTRDXWDAVIMAQIFI*RATLLW 525 Q +F N T T + +++ +++AQ ++ LLW Sbjct: 163 QVTGTPIIFHNLTLITYSLCVISWAVGIGIMLAQYYLQADMLLW 206 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 376 CTRL*TQSNNDSFVFQ 423 CTRL +S SFV Q Sbjct: 409 CTRLNNESRKPSFVIQ 424 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = +1 Query: 394 QSNNDSFVFQN*TRFTSKILLVTRDXWDAVIMAQIFI*RATLLW 525 Q +F N T T + +++ +++AQ ++ LLW Sbjct: 163 QVTGTPIIFHNLTLITYSLCVISWAVGIGIMLAQYYLQADMLLW 206 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 391 TQSNNDSFVFQN 426 TQ N+D F+F N Sbjct: 144 TQQNSDVFIFDN 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,187 Number of Sequences: 336 Number of extensions: 3016 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -