BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120829.seq (668 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0220 - 6531255-6532667 28 5.9 02_01_0102 - 749122-749799,750123-750371,750753-750851,751380-75... 28 7.7 >03_02_0220 - 6531255-6532667 Length = 470 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +3 Query: 579 MADCSALLTHITGHGLFPGRLFI*T--GGF 662 M + +LL +TG G+ P R+F+ T GGF Sbjct: 277 MGEALSLLDRMTGRGVMPNRVFVRTLVGGF 306 >02_01_0102 - 749122-749799,750123-750371,750753-750851,751380-751889, 752025-753905,754093-754296,754807-754899,755036-755122, 755241-755328,755533-755645,755943-757259,757398-758672, 759166-759273 Length = 2233 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +3 Query: 36 KDDVICFSKLNDVICFSKLNWLYE*NSTCKTQSKNDVICRM 158 K D L+D IC S L Y NS+C Q + CRM Sbjct: 1177 KVDCSALVTLSDAICHSALFVCYIVNSSCHLQESIVLRCRM 1217 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,325,686 Number of Sequences: 37544 Number of extensions: 266312 Number of successful extensions: 398 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -