BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120829.seq (668 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16252| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 29 3.4 SB_59636| Best HMM Match : Ins_element1 (HMM E-Value=4.6) 29 4.5 >SB_16252| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 580 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = +2 Query: 155 NDVICFSKLNSLYE*NSTCK--HDQKMMSSFTHDYNVFM-YDSFVFQN 289 NDV+ LNS ++ N+ K HDQ F +DYN M Y + F + Sbjct: 220 NDVLTHVTLNSTHKDNNFQKYTHDQIDSLGFPYDYNSIMHYQNMAFSS 267 >SB_59636| Best HMM Match : Ins_element1 (HMM E-Value=4.6) Length = 194 Score = 28.7 bits (61), Expect = 4.5 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +3 Query: 12 NSTCKTQ-SKDDVICFSKLNDVICFSKLNWLYE*NSTCKTQSKNDVICRMMSFVFQN*T 185 N TCK S D+V C +D KL ++ N TCK + ND + R + N T Sbjct: 52 NVTCKLMASHDNVTCKYMTSDDSVTRKLMASHD-NVTCKIMASNDSVTRKLMASHDNVT 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,736,856 Number of Sequences: 59808 Number of extensions: 353216 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -