BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120826.seq (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0082 + 897026-897028,897101-897350,898454-898608,898686-89... 29 4.5 >04_01_0082 + 897026-897028,897101-897350,898454-898608,898686-898967, 899078-899160,899335-899485,899896-899952,900279-900479 Length = 393 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +1 Query: 406 KNETCQMQQSSNGHRNCKQR*KDPKNLRIGRI*FKNLSSLESYETLK-IKLALSK 567 +N Q QQ ++ HR +Q+ ++P RI KNL + + + K +K SK Sbjct: 249 RNAKQQQQQPADAHRKQQQQKQEPSESSSERITMKNLPNPSNQDQRKTLKFGFSK 303 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,516,360 Number of Sequences: 37544 Number of extensions: 239126 Number of successful extensions: 399 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -