SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120826.seq
         (683 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0082 + 897026-897028,897101-897350,898454-898608,898686-89...    29   4.5  

>04_01_0082 +
           897026-897028,897101-897350,898454-898608,898686-898967,
           899078-899160,899335-899485,899896-899952,900279-900479
          Length = 393

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +1

Query: 406 KNETCQMQQSSNGHRNCKQR*KDPKNLRIGRI*FKNLSSLESYETLK-IKLALSK 567
           +N   Q QQ ++ HR  +Q+ ++P      RI  KNL +  + +  K +K   SK
Sbjct: 249 RNAKQQQQQPADAHRKQQQQKQEPSESSSERITMKNLPNPSNQDQRKTLKFGFSK 303


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,516,360
Number of Sequences: 37544
Number of extensions: 239126
Number of successful extensions: 399
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 397
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 399
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1733104716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -