BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120825.seq (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0603 - 17898310-17899457,17899658-17899747,17900853-17901738 29 3.5 01_01_1052 + 8297105-8297422,8298978-8299310,8299820-8301010 28 6.1 >04_03_0603 - 17898310-17899457,17899658-17899747,17900853-17901738 Length = 707 Score = 29.1 bits (62), Expect = 3.5 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +3 Query: 228 LGNSLYNPRFFSKNILHQG**KRNLFYLLIKLYKVNQFTYFGMISLPYINEFT 386 + +S YNP FSK + G NL Y L N+FT G SL YI++ T Sbjct: 89 ISSSCYNP--FSKRMYSSGW-GFNLSYTPFMLSDSNKFTVVGCQSLAYISDPT 138 >01_01_1052 + 8297105-8297422,8298978-8299310,8299820-8301010 Length = 613 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 592 NRLLQSMCIPPNKFYKIYDSRASHAL 515 NR+LQ C+PP +++D+R L Sbjct: 283 NRVLQQACVPPLSRQEVHDARVGSVL 308 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,251,705 Number of Sequences: 37544 Number of extensions: 303422 Number of successful extensions: 568 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 557 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -