BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120824.seq (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G7.01c |erg7|SPAC4G9.21c|lanosterol synthase Erg7 |Schizos... 27 2.5 SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p... 27 2.5 >SPAC13G7.01c |erg7|SPAC4G9.21c|lanosterol synthase Erg7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 721 Score = 27.1 bits (57), Expect = 2.5 Identities = 15/60 (25%), Positives = 33/60 (55%) Frame = +1 Query: 82 EDTFTLRYVLEQGNLQVKFVAKDIASSLKYVNCKQAVIVNVDKKYKTTYSESGSIPYTRL 261 E +FTL+ ++E G + + DIA +L++++ +Q Y+ Y+ G+ P++ + Sbjct: 386 ETSFTLQALVESGLYEKEAFKPDIAKALEFLDRQQIRTQYEGSGYR--YNSLGAWPFSNI 443 >SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 728 Score = 27.1 bits (57), Expect = 2.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 Query: 315 LITKEGVIQLIMKSKLPYAV 374 L+ K+GV+ L+ K KLP++V Sbjct: 542 LLVKDGVVHLVDKVKLPFSV 561 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,742,038 Number of Sequences: 5004 Number of extensions: 56019 Number of successful extensions: 155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -