BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120821.seq (693 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_458| Best HMM Match : DUF19 (HMM E-Value=1.5) 30 2.0 SB_5915| Best HMM Match : zf-TAZ (HMM E-Value=0.06) 29 2.7 SB_28959| Best HMM Match : Metallophos (HMM E-Value=2.8) 29 4.7 >SB_458| Best HMM Match : DUF19 (HMM E-Value=1.5) Length = 518 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 294 YLLIRGDYESSSELKSLRDLNPWVQNTLLKLL 389 Y L+RG +SS E+KS+R +PW LL L+ Sbjct: 68 YYLVRGFLKSSEEMKSIRH-SPWSVVALLTLV 98 >SB_5915| Best HMM Match : zf-TAZ (HMM E-Value=0.06) Length = 285 Score = 29.5 bits (63), Expect = 2.7 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +1 Query: 127 AINRLFGATETIDFHPNLLVYRQSSPPVRLTGDVYVVDKNEKVF 258 A++RL A+ + H N + R S P +TG+ Y+ ++++ Sbjct: 9 ALSRLHRASFHLTLHDNQFLGRASEQPCDVTGEYYINQPRDRIY 52 >SB_28959| Best HMM Match : Metallophos (HMM E-Value=2.8) Length = 597 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +3 Query: 48 CEQRHFAIERHYERVLRAQAAYIKYFGYKSFVWRHGNYRLSSQPARVPAEFAAG 209 CE R+F+ + H VL+A++ +++ G +S + G L+ P + + +G Sbjct: 142 CEMRYFSYDGHGVPVLKARSNTVEFKG-RSAIPLQGRIALTGDPTEMRVMWTSG 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,305,412 Number of Sequences: 59808 Number of extensions: 339075 Number of successful extensions: 829 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -