BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120821.seq (693 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 8.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 2.8 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = -1 Query: 300 KDMQAPCLRTRV*LKNFFVLINNIHVARQTDRRRTLPVHEQVGMKVDSFRGAKQTIYSQN 121 +D++ PCL V + V + +DR R LP +VD + + Y +N Sbjct: 1292 EDVKLPCLAVGVPAPEVTWKVRGA-VLQSSDRLRQLPEGSLFIKEVDRTDAGEYSCYVEN 1350 Query: 120 T 118 T Sbjct: 1351 T 1351 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 Query: 73 SIAKCLCSQKCTTIH 29 +IA C+C +KC H Sbjct: 100 TIAVCVCMRKCPRRH 114 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,124 Number of Sequences: 438 Number of extensions: 3482 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -