BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120821.seq (693 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37080.1 68418.m04451 hypothetical protein includes At5g37080... 29 3.9 At5g22180.1 68418.m02582 hypothetical protein 28 6.8 >At5g37080.1 68418.m04451 hypothetical protein includes At5g37080, At5g37170, At2g05090 Length = 566 Score = 28.7 bits (61), Expect = 3.9 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -1 Query: 213 TDRRRTLPVHEQVGMKVDSFRGAKQTIYSQNT*YTLLGRVERV 85 TD + PV + V + + F G K Y +N +LG+V RV Sbjct: 132 TDVIKCDPVSDSVFLDLADFEGVKTESYDENVLIDILGQVVRV 174 >At5g22180.1 68418.m02582 hypothetical protein Length = 169 Score = 27.9 bits (59), Expect = 6.8 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 94 YAPKQRILSILAINRLFGATETIDFHPNLLVYRQSSPPVRLTGD 225 + P+QR+L + ++ AT IDF LV SS P++ GD Sbjct: 58 FMPRQRLLESITVSPSSSATLHIDF----LVKPSSSCPIQYNGD 97 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,501,536 Number of Sequences: 28952 Number of extensions: 227419 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -