Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120818.seq
         (669 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    26   0.24 
AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory recept...    21   9.1  

>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 26.2 bits (55), Expect = 0.24
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 3/42 (7%)
 Frame = +1

Query: 367 PNITDIDNIKLSHMQ---LARLLCYTAVVESRNSKPWKAIFN 483
           P +T  DN+KL  +     A  +  T++VES  + P K IFN
Sbjct: 711 PQVTCPDNMKLEKVPGECCAICVNATSLVESNRNVPQKCIFN 752


>AM292363-1|CAL23175.2|  347|Tribolium castaneum gustatory receptor
           candidate 42 protein.
          Length = 347

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +2

Query: 503 QIFFQLYHEYF 535
           Q++FQ Y+ YF
Sbjct: 151 QLYFQFYYTYF 161


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 154,619
Number of Sequences: 336
Number of extensions: 3268
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17385535
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)