BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120818.seq (669 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 25 0.65 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.0 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 21 8.0 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 21 8.0 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 21 8.0 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 25.0 bits (52), Expect = 0.65 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +2 Query: 119 QKLSAMLLNYKKSNKNVPNIKFDLKNLSFMLENTDKIDIIQFDDVKTMYN 268 QK+ + L YKK + + + F N DK+ FD T+ N Sbjct: 425 QKILSYFLRYKKLQPQYSQSELQMPGVKFESVNIDKL-YTYFDKCDTLIN 473 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/43 (20%), Positives = 25/43 (58%) Frame = +3 Query: 486 RHMRFDRFFFNYIMNILNMIKTNQGIPGLTICRWYTIIGKLSQ 614 +++ ++ ++++++ L + + IPG I W+T G +S+ Sbjct: 518 KYLTYEYPWWSHVLGWLCGLSSMLCIPGYMIYIWFTTSGTISE 560 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/43 (20%), Positives = 25/43 (58%) Frame = +3 Query: 486 RHMRFDRFFFNYIMNILNMIKTNQGIPGLTICRWYTIIGKLSQ 614 +++ ++ ++++++ L + + IPG I W+T G +S+ Sbjct: 571 KYLTYEYPWWSHVLGWLCGLSSMLCIPGYMIYIWFTTSGTISE 613 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 52 KQQFIDDHFL*KRVPR 5 +Q+ IDDHFL K R Sbjct: 161 QQKLIDDHFLFKEGDR 176 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.4 bits (43), Expect = 8.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 Query: 605 FSNNGIPPTDC 573 F GIPPT C Sbjct: 139 FDQTGIPPTTC 149 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 52 KQQFIDDHFL*KRVPR 5 +Q+ IDDHFL K R Sbjct: 177 QQKLIDDHFLFKEGDR 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,083 Number of Sequences: 438 Number of extensions: 3642 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -