BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120811.seq (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 1.1 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 3.4 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.4 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.4 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 7.8 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 242 LQRDRAGKHVPRAVFVDLEPTVVDEVRTGTYRQL 343 L+ RA H+ + D+EPTV RQL Sbjct: 234 LEERRAQSHLEAHCYFDIEPTVQQHQPVTVNRQL 267 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 150 PSRHYRSGLR 121 P RHYRSGL+ Sbjct: 139 PLRHYRSGLK 148 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 213 RWSCLWASGHQAGCRAPGSKAPSRHYR 133 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 213 RWSCLWASGHQAGCRAPGSKAPSRHYR 133 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -2 Query: 213 RWSCLWASGHQAGCRAPGSKAPSRHYR 133 RW C W+ G C+A A SR R Sbjct: 387 RW-CTWSEGDLEKCKALTRAAYSRDVR 412 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 587 SSLDFLP*STERRSINKEVNPEPVPPRRSGRS 492 SS+D + ER + ++ P P PP SG++ Sbjct: 1336 SSIDSDYSTLERTAWRQQQPPPPPPPPSSGQA 1367 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,143 Number of Sequences: 438 Number of extensions: 4444 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -