BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120810.seq (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 5.1 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 6.7 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 5.1 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +2 Query: 542 VHTLVNDIQKYTHGER*QQNKHVRQNAD-KKKRRPC 646 VH++V+D G+ +NK RQ A PC Sbjct: 658 VHSIVDDSDVGPSGDCFYENKFYRQEAQWTSSDNPC 693 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 6.7 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +3 Query: 267 SEITDSLPDLTLMLDKLAEQLLEAINXMQQTQ--RNELNN 380 S++ DSL D+ ++DKL L ++ +Q Q +N L N Sbjct: 364 SDVVDSLKDVIEIVDKLLNPDL-GLSLLQVAQIFKNLLEN 402 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,093 Number of Sequences: 336 Number of extensions: 2308 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -