Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120809.seq
         (649 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-3450|AAF46891.3|  203|Drosophila melanogaster CG13518-P...    29   7.2  

>AE013599-3450|AAF46891.3|  203|Drosophila melanogaster CG13518-PA
           protein.
          Length = 203

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = -2

Query: 192 IKISIFKTFILTGRRQGQIAVRAHCRRVN--HSKQCN**CNHYD 67
           ++I      I++ R  G +AVR HCR +   H +  +  C H D
Sbjct: 2   LRIGFVICVIISLRLNGLVAVRVHCRHMERIHEENIHHCCKHQD 45


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,516,377
Number of Sequences: 53049
Number of extensions: 651866
Number of successful extensions: 1562
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1505
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1562
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2744900550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)