BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120808.seq (631 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66524-5|CAC70104.1| 566|Caenorhabditis elegans Hypothetical pr... 29 3.6 AL137227-9|CAE17839.1| 220|Caenorhabditis elegans Hypothetical ... 27 8.4 >Z66524-5|CAC70104.1| 566|Caenorhabditis elegans Hypothetical protein T13H5.8 protein. Length = 566 Score = 28.7 bits (61), Expect = 3.6 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +1 Query: 184 IQHHAPDSVAKQGDPLYLHXHTVLLPN 264 +Q P SVAK G YL+ HT+LLP+ Sbjct: 91 LQVKIPSSVAKDG---YLYAHTILLPH 114 >AL137227-9|CAE17839.1| 220|Caenorhabditis elegans Hypothetical protein F58D5.9 protein. Length = 220 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -2 Query: 600 PANAVWPKLRRFRGARFSKSCXTRFSVASSQIISLANK--*ANRLASAQICVGPPS 439 P+ A WPK++ + SK RF + LA + A RL + ++C+ PS Sbjct: 60 PSTADWPKMKFGQDYEHSKCPDARFQRHVEENCQLAEQYIAAGRLLAFEVCMVTPS 115 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,154,401 Number of Sequences: 27780 Number of extensions: 313702 Number of successful extensions: 784 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -