BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120806.seq (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0883 + 28483429-28484385,28485090-28485398 28 5.6 05_04_0035 + 17378541-17381276 28 7.4 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 27 9.8 >03_05_0883 + 28483429-28484385,28485090-28485398 Length = 421 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = +2 Query: 104 KMRIKEKEQGSASRMRMKIMKKVNPRAKKRKCRIMPKAKLHRPRRMPRNEQPPGDP 271 + R K + + A ++R ++ K + + K R + +A P +PR++ PP P Sbjct: 344 RYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAAALPPLPLPRHQHPPPPP 399 >05_04_0035 + 17378541-17381276 Length = 911 Score = 27.9 bits (59), Expect = 7.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +2 Query: 179 RAKKRKCRIMPKAKLHRPRRMPRNEQPPGDP 271 R +KR+ RI P LH RR P PP DP Sbjct: 69 RRRKRRLRIEPP--LHALRRDPSAPPPPRDP 97 >02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089, 5271153-5271263,5271363-5271434,5271533-5271604, 5272126-5272197,5272281-5272346,5272426-5272491, 5272601-5272971,5273203-5273456,5273886-5274157, 5274333-5274474,5275174-5275313,5275381-5275537, 5275797-5275965,5276048-5276088 Length = 772 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 351 LAGWSHPRLHNLDIIIPKMATVRLAQNGSPGGCSFLGILLGRC 223 L W+ P LHNLD + ++ R+ + P S LG ++ C Sbjct: 660 LVDWASPHLHNLD-SLERITDPRIHASMPPQAISTLGNIILLC 701 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,138,313 Number of Sequences: 37544 Number of extensions: 241061 Number of successful extensions: 603 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -