BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120806.seq (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.8 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -2 Query: 283 TSPKWVSRRLFISWHSSWAMQLCLWHYSTF 194 T+P+ ++ R F S W+M + W ++ Sbjct: 805 TAPEAIAFRKFTSASDVWSMGIVCWEVMSY 834 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -3 Query: 336 HPRLHNLDIIIPKMATVRLAQNGSPGGCSFLGILLGRCSFAF 211 +P HN + IPK +V + + G + +LLG F Sbjct: 1478 NPDNHNEKLHIPKDKSVSVLSRENEAGQKEVKVLLGSDKIKF 1519 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,240 Number of Sequences: 438 Number of extensions: 2657 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -