BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120804.seq (530 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 28 4.1 SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) 27 7.2 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/61 (26%), Positives = 27/61 (44%) Frame = +3 Query: 321 YTTMELNRXTRPAHLVMXPXRAAPQTLISRNLXSMXIVFKGITPTKTV*GXWHVAIRSRQ 500 YT+ E+N+ + + R PQ I ++ +V++ P V IR+RQ Sbjct: 18 YTSDEVNKVRSVFEITLLLERYMPQKWIYGGRYTLDVVYEVTKPRSATIDSCFVLIRTRQ 77 Query: 501 H 503 H Sbjct: 78 H 78 >SB_46059| Best HMM Match : Astacin (HMM E-Value=2.8e-17) Length = 1775 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = +2 Query: 242 RKTATIDDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSSNVXXTRGTANFDIKE 412 RKT ++ I K+ N GT+ + T DYG S N N R T ++E Sbjct: 1385 RKTLAVNKIDKDDDNDDGTDEVVKQTFDDYG--SRNEVVWHGNRIQERSTKRAALEE 1439 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,192,226 Number of Sequences: 59808 Number of extensions: 218859 Number of successful extensions: 411 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1191330434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -