BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120804.seq (530 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 0.68 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 6.4 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 8.4 AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. 23 8.4 AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. 23 8.4 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 26.2 bits (55), Expect = 0.68 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 229 WLNLLSPCAMRKLATRALLSFTFNRLXSSDSTDSXXCPK 113 WL S A++K A+ +S F+R+ D CP+ Sbjct: 100 WLVTASQSALQKFASTDWMSNPFDRVVCGDFAGPNGCPR 138 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 6.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 460 VLVGVIPLNTIXMEXKFLDIKVCGA 386 V+ V+PLNT + + VCGA Sbjct: 784 VVQKVVPLNTFLLPKLWFVASVCGA 808 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 22.6 bits (46), Expect = 8.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 256 SSGFSAIYIWLNLLSPCAMRKLATRALL 173 S GF +YI+LN + KLA R L+ Sbjct: 76 SPGFVGLYIFLNPVLLVTDLKLAKRILI 103 >AM182453-1|CAJ65691.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 308 FLGTVYDYGVKSP 346 F+GT+ DYG+ P Sbjct: 93 FIGTLIDYGLNDP 105 >AM182452-1|CAJ65690.1| 168|Anopheles gambiae globin 1 protein. Length = 168 Score = 22.6 bits (46), Expect = 8.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 308 FLGTVYDYGVKSP 346 F+GT+ DYG+ P Sbjct: 93 FIGTLIDYGLNDP 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 455,008 Number of Sequences: 2352 Number of extensions: 7520 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -