BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120803.seq (660 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19G7.10c |||topoisomerase associated protein |Schizosaccharo... 31 0.15 SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharo... 29 0.59 SPBC215.05 |gpd1||glycerol-3-phosphate dehydrogenase Gpd1|Schizo... 29 0.59 SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9... 27 3.2 SPAC227.11c |||sensor for misfolded ER glycoproteins Yos9 |Schiz... 26 4.2 SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomy... 25 7.3 SPCC1322.12c |bub1||serine/threonine protein kinase Bub1|Schizos... 25 9.7 >SPBC19G7.10c |||topoisomerase associated protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 744 Score = 31.1 bits (67), Expect = 0.15 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 2/69 (2%) Frame = -2 Query: 476 PLNTINMDLNSLISKFAVPRVMVTLLDVLAAFGDLTP*SYTVPRKMLLVPTLLEPSLTMS 297 P+ + L L+S A R T L + A G + + PR++L V EP+ + S Sbjct: 384 PMQKLQQQLQRLVSS-AKERPKATQLSLEGALGKIAVNTVRTPRQLLNVKRPTEPASSNS 442 Query: 296 SID--SGFS 276 S++ SGFS Sbjct: 443 SLNNFSGFS 451 >SPBC4.03c |||COPII-coated vesicle component Sfb3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 29.1 bits (62), Expect = 0.59 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -2 Query: 374 LTP*SYTVPRKMLLVPTLLEPSLTMSSIDSGFSAIYIWLNYYRRVRCA 231 LTP +P+ ++L+P L+ L S+I SG I ++ R VR A Sbjct: 673 LTPGQLVLPKNLVLLPILILAVLKSSAIRSGSIHSDIRVSQLREVRAA 720 >SPBC215.05 |gpd1||glycerol-3-phosphate dehydrogenase Gpd1|Schizosaccharomyces pombe|chr 2|||Manual Length = 385 Score = 29.1 bits (62), Expect = 0.59 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -1 Query: 435 KVCG--AARHGHITRCAGRVWRFNSIVVYGAQKNAVSAHF 322 K+CG A HGH R R+W F + Y +K ++ F Sbjct: 39 KICGENARAHGHHFRSKVRMWVFEEEIEYKGEKRKLTEVF 78 >SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9|Schizosaccharomyces pombe|chr 1|||Manual Length = 1223 Score = 26.6 bits (56), Expect = 3.2 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 295 DDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSSNVTMTR 420 D I + G NK S+ + T+ + SPN+ +T+SN T+ Sbjct: 891 DSIKRLGDNKFEDKSLRICTIPNSIFDSPNSHTTNSNSFFTK 932 >SPAC227.11c |||sensor for misfolded ER glycoproteins Yos9 |Schizosaccharomyces pombe|chr 1|||Manual Length = 322 Score = 26.2 bits (55), Expect = 4.2 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +1 Query: 298 DIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTSSNVTMTRGTANFDIKEFK 453 D +KE + K +S+F ++Y PNA+ N T ++D++E + Sbjct: 64 DSIKEKTEKTKLSSLFYAGKHEYFCVYPNASLIKQNSTT---EPSYDLQELR 112 >SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 541 Score = 25.4 bits (53), Expect = 7.3 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 422 PRVMVTLLDVLAAFGDLTP*SYTVPRKMLLVPTL 321 P V++ V AF +TP YTVP+ +++PTL Sbjct: 384 PPVLMVPYRVKKAF-PITP-DYTVPKDAMVIPTL 415 >SPCC1322.12c |bub1||serine/threonine protein kinase Bub1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1044 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = +1 Query: 271 IAEKPLSIDDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAASTS 399 I +PL + + K + + S +LGT S N+ +TS Sbjct: 396 IFNQPLRSESLEKSSKSPISAQSSYLGTPLKNDENSSNSGATS 438 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,765,443 Number of Sequences: 5004 Number of extensions: 56564 Number of successful extensions: 166 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 166 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -