BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120803.seq (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 26 1.2 AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. 26 1.2 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 8.5 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 8.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 8.5 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 520 SKSTAWIVCLIRPQHGGRCSEREVRELRKSNLHF 621 S T + C+I+ + GG C+ + R +LHF Sbjct: 51 SSITCKMYCVIKGKTGGYCNSEGLCTCRAEDLHF 84 >AY973195-1|AAY41589.1| 80|Anopheles gambiae defensin 2 protein. Length = 80 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 520 SKSTAWIVCLIRPQHGGRCSEREVRELRKSNLHF 621 S T + C+I+ + GG C+ + R +LHF Sbjct: 38 SSITCKMYCVIKGKTGGYCNSEGLCTCRAEDLHF 71 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.0 bits (47), Expect = 8.5 Identities = 6/29 (20%), Positives = 15/29 (51%) Frame = -3 Query: 658 LAEAASVFSCTPRSASWICAIRAPLVRNS 572 L + + ++ C+P W C + +++S Sbjct: 395 LFQISDIYWCSPPGNGWACGVSCDALKDS 423 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 8.5 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 325 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 456 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 8.5 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 325 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 456 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 720,307 Number of Sequences: 2352 Number of extensions: 15221 Number of successful extensions: 54 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -