BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120799.seq (607 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1739.10 |mug33||conserved fungal protein|Schizosaccharomyces... 27 2.1 SPAC4H3.03c |||glucan 1,4-alpha-glucosidase |Schizosaccharomyces... 26 3.7 SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces po... 26 3.7 SPCC1672.12c |||DUF410 family protein|Schizosaccharomyces pombe|... 25 6.5 SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schiz... 25 8.6 SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subuni... 25 8.6 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 25 8.6 >SPCC1739.10 |mug33||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 336 Score = 27.1 bits (57), Expect = 2.1 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 10 ANSRKPFLFYNEDYYCEKPKRYFHTNKVIFEK 105 +N KP + YN DY E K F T+ ++ ++ Sbjct: 52 SNCSKPLVGYNSDYLDEHAKDGFRTSVIVRQR 83 >SPAC4H3.03c |||glucan 1,4-alpha-glucosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 26.2 bits (55), Expect = 3.7 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = -2 Query: 213 QQRKFVFASVVFWQAIIKKIRKQFSASI 130 Q+R F+++ ++ W A+ + +R F+ S+ Sbjct: 437 QERNFLYSKIMLWVALDRALRIAFTRSL 464 >SPAC222.07c |hri2||eIF2 alpha kinase Hri2|Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 26.2 bits (55), Expect = 3.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 76 FHTNKVIFEKLDPYATNINRCRKL 147 F V+FE L P+ TN+ R KL Sbjct: 518 FSLGMVLFELLHPFQTNMERATKL 541 >SPCC1672.12c |||DUF410 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 303 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 Query: 146 NFLHLLIFVAY 114 NFLHLLIF AY Sbjct: 228 NFLHLLIFTAY 238 >SPAC12B10.14c |ppk2||serine/threonine protein kinase Ppk2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -3 Query: 332 IVSSFPSGKLIDLEP 288 +VSSFP+ +IDL+P Sbjct: 37 LVSSFPNDSIIDLQP 51 >SPBC17A3.01c |tim50|SPBC8D2.21c|TIM23 translocase complex subunit Tim50 |Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 28 FLFYNEDYY--CEKPKRYFHTNKVIFEKLDPYATNIN 132 FL Y YY ++Y T K I +K+DPY +I+ Sbjct: 209 FLGYLSMYYEVVIFTRQYLATAKPIIDKIDPYHVSIS 245 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +2 Query: 257 GVNGGIRPKPVARDQ 301 G++GG+RP P A DQ Sbjct: 115 GLDGGVRPLPAAVDQ 129 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,420,542 Number of Sequences: 5004 Number of extensions: 46905 Number of successful extensions: 117 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -