BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120799.seq (607 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g27020.1 68417.m03886 expressed protein gene F20P5.12 of BAC ... 28 4.2 At1g51520.2 68414.m05799 expressed protein contains a weak hit t... 28 4.2 At1g51520.1 68414.m05798 expressed protein contains a weak hit t... 28 4.2 At5g09800.1 68418.m01134 U-box domain-containing protein low sim... 27 9.6 >At4g27020.1 68417.m03886 expressed protein gene F20P5.12 of BAC F20P5 from Arabidopsis thalianachromosome 1, PID:g2194125 Length = 523 Score = 28.3 bits (60), Expect = 4.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 124 SLRTDRVFQKLLCLYENNVWASHNN 50 S+R D V K C YEN W NN Sbjct: 65 SVRNDAVEWKGACFYENKAWLELNN 89 >At1g51520.2 68414.m05799 expressed protein contains a weak hit to PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 513 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 28 FLFYN-EDYYCEKPKRYFHTNKVIFEKLDPYATNINRCRK 144 FLF N ED + KR F N FE +P+ N C + Sbjct: 144 FLFTNDEDPFANSHKRSFSANDACFESEEPWFGGGNGCHQ 183 >At1g51520.1 68414.m05798 expressed protein contains a weak hit to PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 414 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 28 FLFYN-EDYYCEKPKRYFHTNKVIFEKLDPYATNINRCRK 144 FLF N ED + KR F N FE +P+ N C + Sbjct: 144 FLFTNDEDPFANSHKRSFSANDACFESEEPWFGGGNGCHQ 183 >At5g09800.1 68418.m01134 U-box domain-containing protein low similarity to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 409 Score = 27.1 bits (57), Expect = 9.6 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +3 Query: 171 PAKILPTQKQICAAVSSFRTRNQTNRNVSALTAVSDQSR 287 P PT+ +I AA+ FR N + SD++R Sbjct: 90 PESDTPTRDEINAAIERFRIENDARSKILRFARESDENR 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,469,261 Number of Sequences: 28952 Number of extensions: 238393 Number of successful extensions: 504 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -