BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120795.seq (660 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_54230| Best HMM Match : EGF (HMM E-Value=0) 30 1.9 SB_56389| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=2.5) 29 3.4 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 29 4.4 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 29 4.4 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 29 4.4 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 29 4.4 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 29 4.4 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 29 4.4 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 29 4.4 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 29 4.4 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 29 4.4 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 29 4.4 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 29 4.4 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 29 4.4 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 29 4.4 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 29 4.4 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 29 4.4 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 29 4.4 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 29 4.4 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 29 4.4 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 29 4.4 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 29 4.4 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 29 4.4 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 29 4.4 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 29 4.4 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 29 4.4 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 29 4.4 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 29 4.4 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 29 4.4 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 29 4.4 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 29 4.4 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 29 4.4 >SB_55025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = +2 Query: 164 PPDSRR*ACSKTPKRQ*SLIP--LPSRAISMRHDAAVRRXESVQDRPDYKLDAATGFSEL 337 PP R+ + Q +++P L S A ++R + VRR +QDR + D A+ S L Sbjct: 956 PPSLRQSILADIDDSQLNVLPTELASEAQTLRRETEVRRQRMIQDRFAFGGDTASAISAL 1015 >SB_54230| Best HMM Match : EGF (HMM E-Value=0) Length = 1359 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +2 Query: 83 YSCSCAPR*PTRRSCKIGFTNTCCPSAPPDSRR*ACS 193 Y CSC P T + C+ G N C PS+ P CS Sbjct: 899 YRCSCCPPCFTGQHCEKGI-NKCIPSSNPCKNGATCS 934 >SB_56389| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=2.5) Length = 473 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 465 Q*TSPAVAVRSQLLFHQLFEQRVVHGGL 382 Q T P++A+R QL+F + E +V+ GGL Sbjct: 371 QLTIPSLAIRLQLMFDSITEIQVLFGGL 398 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 115 LMRYFLLTHLCGISHRIWCTLSTICS 140 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 93 LMRYFLLTHLCGISHRIWCTLSTICS 118 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 102 LMRYFLLTHLCGISHRIWCTLSTICS 127 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 167 LMRYFLLTHLCGISHRIWCTLSTICS 192 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 92 LMRYFLLTHLCGISHRIWCTLSTICS 117 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 141 LMRYFLLTHLCGISHRIWCTLSTICS 166 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 206 LMRYFLLTHLCGISHRIWCTLSTICS 231 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 110 LMRYFLLTHLCGISHRIWCTLSTICS 135 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 113 LMRYFLLTHLCGISHRIWCTLSTICS 138 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 93 LMRYFLLTHLCGISHRIWCTLSTICS 118 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 128 LMRYFLLTHLCGISHRIWCTLSTICS 153 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 126 LMRYFLLTHLCGISHRIWCTLSTICS 151 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 112 LMRYFLLTHLCGISHRIWCTLSTICS 137 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 141 LMRYFLLTHLCGISHRIWCTLSTICS 166 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 153 LMRYFLLTHLCGISHRIWCTLSTICS 178 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 178 LMRYFLLTHLCGISHRIWCTLSTICS 203 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 149 LMRYFLLTHLCGISHRIWCTLSTICS 174 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 114 LMRYFLLTHLCGISHRIWCTLSTICS 139 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 137 LMRYFLLTHLCGISHRIWCTLSTICS 162 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 137 LMRYFLLTHLCGISHRIWCTLSTICS 162 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 137 LMRYFLLTHLCGISHRIWCTLSTICS 162 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 118 LMRYFLLTHLCGISHRIWCTLSTICS 143 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 161 LMRYFLLTHLCGISHRIWCTLSTICS 186 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 129 LMRYFLLTHLCGISHRIWCTLSTICS 154 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 120 LMRYFLLTHLCGISHRIWCTLSTICS 145 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 144 LMRYFLLTHLCGISHRIWCTLSTICS 169 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 94 LMRYFLLTHLCGISHRIWCTLSTICS 119 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 187 LMRYFLLTHLCGISHRIWCTLSTICS 212 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 235 LMRYFLLTHLCGISHRIWCTLSTICS 260 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 112 LMRYFLLTHLCGISHRIWCTLSTICS 137 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 199 LMRYFLLTHLCGISHRIWCTLSTICS 224 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 169 LMRYFLLTHLCGISHRIWCTLSTICS 194 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 214 LMRYFLLTHLCGISHRIWCTLSTICS 239 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 123 LMRYFLLTHLCGISHRIWCTLSTICS 148 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 124 LMRYFLLTHLCGISHRIWCTLSTICS 149 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 132 LMRYFLLTHLCGISHRIWCTLSTICS 157 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 126 LMRYFLLTHLCGISHRIWCTLSTICS 151 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 123 LMRYFLLTHLCGISHRIWCTLSTICS 148 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 157 LMRYFLLTHLCGISHRIWCTLSTICS 182 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 116 LMRYFLLTHLCGISHRIWCTLSTICS 141 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 126 LMRYFLLTHLCGISHRIWCTLSTICS 151 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 126 LMRYFLLTHLCGISHRIWCTLSTICS 151 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 127 LMRYFLLTHLCGISHRIWCTLSTICS 152 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 98 LMRYFLLTHLCGISHRIWCTLSTICS 123 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 136 LMRYFLLTHLCGISHRIWCTLSTICS 161 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 229 LMRYFLLTHLCGISHRIWCTLSTICS 254 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 84 LMRYFLLTHLCGISHRIWCTLSTICS 109 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 136 LMRYFLLTHLCGISHRIWCTLSTICS 161 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 102 LMRYFLLTHLCGISHRIWCTLSTICS 127 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 121 LMRYFLLTHLCGISHRIWCTLSTICS 146 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 110 LMRYFLLTHLCGISHRIWCTLSTICS 135 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 122 LMRYFLLTHLCGISHRIWCTLSTICS 147 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 115 LMRYFLLTHLCGISHRIWCTLSTICS 140 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 134 LMRYFLLTHLCGISHRIWCTLSTICS 159 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 140 LMRYFLLTHLCGISHRIWCTLSTICS 165 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 157 LMRYFLLTHLCGISHRIWCTLSTICS 182 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 103 LMRYFLLTHLCGISHRIWCTLSTICS 128 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 179 LMRYFLLTHLCGISHRIWCTLSTICS 204 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 122 LMRYFLLTHLCGISHRIWCTLSTICS 147 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 108 LMRYFLLTHLCGISHRIWCTLSTICS 133 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 107 LMRYFLLTHLCGISHRIWCTLSTICS 132 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 141 LMRYFLLTHLCGISHRIWCTLSTICS 166 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 108 LMRYFLLTHLCGISHRIWCTLSTICS 133 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 118 LMRYFLLTHLCGISHRIWCTLSTICS 143 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 220 LMRYFLLTHLCGISHRIWCTLSTICS 245 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 132 LMRYFLLTHLCGISHRIWCTLSTICS 157 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 110 LMRYFLLTHLCGISHRIWCTLSTICS 135 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 158 LMRYFLLTHLCGISHRIWCTLSTICS 183 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 172 LMRYFLLTHLCGISHRIWCTLSTICS 197 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 205 LMRYFLLTHLCGISHRIWCTLSTICS 230 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 155 LMRYFLLTHLCGISHRIWCTLSTICS 180 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 87 LMRYFLLTHLCGISHRIWCTLSTICS 112 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 122 LMRYFLLTHLCGISHRIWCTLSTICS 147 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 179 LMRYFLLTHLCGISHRIWCTLSTICS 204 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 138 LMRYFLLTHLCGISHRIWCTLSTICS 163 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 146 LMRYFLLTHLCGISHRIWCTLSTICS 171 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 125 LMRYFLLTHLCGISHRIWCTLSTICS 150 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 146 LMRYFLLTHLCGISHRIWCTLSTICS 171 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 160 LMRYFLLTHLCGISHRIWCTLSTICS 185 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 134 LMRYFLLTHLCGISHRIWCTLSTICS 159 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 161 LMRYFLLTHLCGISHRIWCTLSTICS 186 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 359 LMRYFLLTHLCGISHRIWCTLSTICS 384 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 109 LMRYFLLTHLCGISHRIWCTLSTICS 134 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 300 LMRYFLLTHLCGISHRIWCTLSTICS 325 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 134 LMRYFLLTHLCGISHRIWCTLSTICS 159 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 101 LMRYFLLTHLCGISHRIWCTLSTICS 126 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 77 LMRYFLLTHLCGISHRIWCTLSTICS 102 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 116 LMRYFLLTHLCGISHRIWCTLSTICS 141 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 83 LMRYFLLTHLCGISHRIWCTLSTICS 108 >SB_30093| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 201 GVLEQAQRRLSGGALGQHVFVKPILQLRRVGHLGAHEQLYNAYFVE 64 GVL + R L V + + RR+ +L AHE +Y Y + Sbjct: 207 GVLHKIPRVLGNTLASCQVLCRSCKEPRRLDNLAAHEAIYTTYIAQ 252 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 138 LMRYFLLTHLCGISHRIWCTLSTICS 163 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 85 LMRYFLLTHLCGISHRIWCTLSTICS 110 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 162 LMRYFLLTHLCGISHRIWCTLSTICS 187 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 113 LMRYFLLTHLCGISHRIWCTLSTICS 138 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 120 LMRYFLLTHLCGISHRIWCTLSTICS 145 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 97 LMRYFLLTHLCGISHRIWCTLSTICS 122 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 115 LMRYFLLTHLCGISHRIWCTLSTICS 140 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 28.7 bits (61), Expect = 4.4 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 449 LLRYGLNSCFISFSSSVWCTVGSVCS 372 L+RY L + S +WCT+ ++CS Sbjct: 122 LMRYFLLTHLCGISHRIWCTLSTICS 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,864,488 Number of Sequences: 59808 Number of extensions: 401283 Number of successful extensions: 1190 Number of sequences better than 10.0: 101 Number of HSP's better than 10.0 without gapping: 1129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1190 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -