BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120795.seq (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. 23 6.5 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 23 8.5 >DQ974171-1|ABJ52811.1| 403|Anopheles gambiae serpin 14 protein. Length = 403 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 439 YRNSGRGLLHGFRAHQARARDVL 507 +R R +++GFR AR RD++ Sbjct: 110 FRMKNRIIVNGFREVDARMRDIM 132 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 23.0 bits (47), Expect = 8.5 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -3 Query: 292 ILNRFXSAYSSVVPHRNGPRRERN*TLLSLGR 197 ++ F Y + + NG R+ER L +GR Sbjct: 403 VVENFRERYFTQLAEDNGTRKERRLELREVGR 434 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 669,987 Number of Sequences: 2352 Number of extensions: 13406 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -