BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120795.seq (660 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC107479-1|AAI07480.1| 1238|Homo sapiens C10orf137 protein protein. 30 8.4 BC105929-1|AAI05930.1| 593|Homo sapiens C10orf137 protein protein. 30 8.4 BC026172-1|AAH26172.1| 796|Homo sapiens C10orf137 protein protein. 30 8.4 AL158835-4|CAH73214.1| 1142|Homo sapiens erythroid differentiati... 30 8.4 >BC107479-1|AAI07480.1| 1238|Homo sapiens C10orf137 protein protein. Length = 1238 Score = 29.9 bits (64), Expect = 8.4 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 52 QTILLDKIGVIQLFMRSKMTNAAELQNWFYEHVLPQ 159 +T+LLD++ + +LFMRS T FY+ ++ Q Sbjct: 152 RTLLLDELDIQELFMRSSQTGDWTWLKEFYQRLIDQ 187 >BC105929-1|AAI05930.1| 593|Homo sapiens C10orf137 protein protein. Length = 593 Score = 29.9 bits (64), Expect = 8.4 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 52 QTILLDKIGVIQLFMRSKMTNAAELQNWFYEHVLPQ 159 +T+LLD++ + +LFMRS T FY+ ++ Q Sbjct: 152 RTLLLDELDIQELFMRSSQTGDWTWLKEFYQRLIDQ 187 >BC026172-1|AAH26172.1| 796|Homo sapiens C10orf137 protein protein. Length = 796 Score = 29.9 bits (64), Expect = 8.4 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 52 QTILLDKIGVIQLFMRSKMTNAAELQNWFYEHVLPQ 159 +T+LLD++ + +LFMRS T FY+ ++ Q Sbjct: 152 RTLLLDELDIQELFMRSSQTGDWTWLKEFYQRLIDQ 187 >AL158835-4|CAH73214.1| 1142|Homo sapiens erythroid differentiation-related factor 1 (EDRF1) protein. Length = 1142 Score = 29.9 bits (64), Expect = 8.4 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 52 QTILLDKIGVIQLFMRSKMTNAAELQNWFYEHVLPQ 159 +T+LLD++ + +LFMRS T FY+ ++ Q Sbjct: 152 RTLLLDELDIQELFMRSSQTGDWTWLKEFYQRLIDQ 187 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,266,135 Number of Sequences: 237096 Number of extensions: 1811348 Number of successful extensions: 4533 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4533 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7422585720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -