BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120794.seq (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.14 |||mitochondrial ribosomal protein subunit S26|Schiz... 30 0.26 SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharo... 26 5.5 SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa... 25 9.7 >SPBC16A3.14 |||mitochondrial ribosomal protein subunit S26|Schizosaccharomyces pombe|chr 2|||Manual Length = 277 Score = 30.3 bits (65), Expect = 0.26 Identities = 19/50 (38%), Positives = 20/50 (40%) Frame = +2 Query: 293 NNSLRAKLELGRAVHYTLRCRCVTGTRRRSQQNNCGRRHVRPRLDRRNKL 442 N LR L L H RC VT R N C H P L +RN L Sbjct: 3 NTGLRKGLALSPITHLLKRCSSVTDNVHRV--NYCYNYHTVPNLSQRNLL 50 >SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharomyces pombe|chr 2|||Manual Length = 1309 Score = 25.8 bits (54), Expect = 5.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 235 IFLMTYDLKGLGQTRIWATKQQSTRQVGTRKSCTLHI 345 IFL D + G TRI +K +T Q R + T H+ Sbjct: 877 IFLTNLDYRLEGHTRIIFSKALNTGQQAVRLTATKHL 913 >SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosaccharomyces pombe|chr 3|||Manual Length = 877 Score = 25.0 bits (52), Expect = 9.7 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = -3 Query: 654 FLNTEVERCQNGNQNRLLLLIENVRRLSGAVKRVHIIVEIFLNL 523 FL +VE C+NG+ +R L + RL + I+VE+ L L Sbjct: 639 FLYMQVELCENGSLDRFLEEQGQLSRLD-EFRVWKILVEVALGL 681 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,619,155 Number of Sequences: 5004 Number of extensions: 51745 Number of successful extensions: 118 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -