BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120794.seq (659 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 23 3.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 7.9 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 22.6 bits (46), Expect = 3.4 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -3 Query: 633 RCQNGNQNRLLLLIENVRRLSGAV 562 +C NQN +L +IE V + GA+ Sbjct: 62 QCDLSNQNDILKVIEWVEKNLGAI 85 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/48 (20%), Positives = 21/48 (43%) Frame = +3 Query: 255 FKGAWSNTDLGYQTTVYAPSWNSEELYTTHYAVDALLEQGVDPNKIIV 398 F G + +T++G + +N E TH +D + +K ++ Sbjct: 295 FNGWYMSTEIGSRDLCDVQRYNLLETIATHMGLDTRTSTSLWKDKAMI 342 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,483 Number of Sequences: 438 Number of extensions: 3521 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -