Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120792.seq
         (649 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.           24   3.6  
AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           23   6.3  
AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.           23   6.3  
AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.           23   6.3  
AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.           23   6.3  
AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.           23   6.3  
AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.           23   6.3  
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           23   6.3  
AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein prot...    23   6.3  
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    23   8.3  
AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcript...    23   8.3  

>AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.
          Length = 897

 Score = 24.2 bits (50), Expect = 3.6
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = +1

Query: 325 QYFKDEHYSVSCQNGSVLKSK 387
           QY +D+HYS+     S LK +
Sbjct: 556 QYSRDDHYSLQINPDSYLKQR 576


>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 165 WSAPTTTTTW 174


>AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 165 WSAPTTTTTW 174


>AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 165 WSAPTTTTTW 174


>AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 164 WSAPTTTTTW 173


>AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 164 WSAPTTTTTW 173


>AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 165 WSAPTTTTTW 174


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 165 WSAPTTTTTW 174


>AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein
           protein.
          Length = 373

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +2

Query: 467 WSANTTTATW 496
           WSA TTT TW
Sbjct: 165 WSAPTTTTTW 174


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
           polyprotein protein.
          Length = 1726

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +2

Query: 428 SLLKLTKNTVCPNWSANTTTATWRYACEAG 517
           ++LK +   +C  +SAN+   T R A   G
Sbjct: 295 NILKSSAQNICNQYSANSIMVTGRQARRDG 324


>AB090818-2|BAC57912.1|  988|Anopheles gambiae reverse transcriptase
           protein.
          Length = 988

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 12/44 (27%), Positives = 22/44 (50%)
 Frame = +1

Query: 214 YAQEQRFARQNKIKVDEQFDQLEREYSDKIDGFHDNIQYFKDEH 345
           Y  ++RF   N+ + +EQ ++  +  SD        I+  KD+H
Sbjct: 302 YGMQRRF---NRARTEEQREERRQIKSDARAALQQAIKLSKDQH 342


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 651,906
Number of Sequences: 2352
Number of extensions: 13227
Number of successful extensions: 21
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63977715
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)