BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120792.seq (649 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF220353-1|AAF32355.1| 2244|Drosophila melanogaster kinesin-like... 33 0.33 AE014134-2053|AAF53088.2| 2013|Drosophila melanogaster CG6392-PA... 33 0.33 AF313479-1|AAG29545.1| 4167|Drosophila melanogaster 1-beta dynei... 29 7.2 >AF220353-1|AAF32355.1| 2244|Drosophila melanogaster kinesin-like kinetochore motorprotein CENP-meta protein. Length = 2244 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +1 Query: 292 SDKIDGFHDNIQYFK--DEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKY 453 +DKI ++Q F ++H+ V C+ LK K A++ D +++S+ E+Y Sbjct: 505 TDKIKKEIQDLQMFTSLEKHFEVECEEVQGLKEKLAEVTAQRDNLEQESLAEKERY 560 >AE014134-2053|AAF53088.2| 2013|Drosophila melanogaster CG6392-PA protein. Length = 2013 Score = 33.1 bits (72), Expect = 0.33 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +1 Query: 292 SDKIDGFHDNIQYFK--DEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKY 453 +DKI ++Q F ++H+ V C+ LK K A++ D +++S+ E+Y Sbjct: 505 TDKIKKEIQDLQMFTSLEKHFEVECEEVQGLKEKLAEVTAQRDNLEQESLAEKERY 560 >AF313479-1|AAG29545.1| 4167|Drosophila melanogaster 1-beta dynein protein. Length = 4167 Score = 28.7 bits (61), Expect = 7.2 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 370 SVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLVGKHNDCYVAV 501 SV+ KF + + D KKS + ++K C L+ + D Y+ + Sbjct: 309 SVVLKKFESVRREFDKEVKKSFDEWQKNCCSLLLNQKLDRYLLI 352 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,728,779 Number of Sequences: 53049 Number of extensions: 536397 Number of successful extensions: 1555 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1555 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2744900550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -