BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120790.seq (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 24 0.93 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 4.9 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 24.2 bits (50), Expect = 0.93 Identities = 19/59 (32%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Frame = -1 Query: 493 CGNGC-GYDCASXYDGGNETWTCACDRNDSCMAMRGDHIAPSEREVPCRPTFVRPSCPG 320 C +G GY C D + AC N +C+ G E C P FV P C G Sbjct: 248 CPSGTLGYICEINVD---DCRPGACHNNGTCLDKVGGF------ECKCPPGFVGPRCEG 297 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 371 RWRDMVAPHRHTGVV 415 RWRD + H+GVV Sbjct: 310 RWRDRIYDAIHSGVV 324 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,883 Number of Sequences: 336 Number of extensions: 2578 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -