BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120790.seq (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 9e-19 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 41 7e-04 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 41 0.001 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 40 0.002 SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) 37 0.016 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 37 0.016 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 36 0.028 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 36 0.037 SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) 35 0.049 SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) 35 0.049 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.049 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 34 0.085 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.085 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.085 SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 33 0.26 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 31 0.80 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.80 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 31 0.80 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 31 1.1 SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 31 1.1 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 30 1.4 SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 29 2.4 SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) 29 2.4 SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) 29 2.4 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 29 3.2 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 3.2 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 29 3.2 SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) 29 3.2 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 29 3.2 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 29 4.2 SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_43406| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) 28 5.6 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 90.6 bits (215), Expect = 9e-19 Identities = 46/91 (50%), Positives = 54/91 (59%) Frame = +2 Query: 122 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGKVEDSPS*GFSS 301 R PP IDGM SLKVDNLTYRTT EDL++VF++ G++GDIYIPRDR + F Sbjct: 7 RGPPEIDGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYE 66 Query: 302 VVMLKKPWTRWTDECWTAGNFAFRWRDMVAP 394 + C A F FRWRDMV P Sbjct: 67 KRDAEDAMDCMDATCLMAEKFVFRWRDMVVP 97 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/40 (42%), Positives = 28/40 (70%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T+ RGFAFV F +++ E+A++ +DG+ DGR ++V A Sbjct: 266 TQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQA 305 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T RGF FV F + ++A+D DG LDGR ++V A Sbjct: 46 TGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKA 85 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 42.7 bits (96), Expect = 2e-04 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 R GFAF F +RRDAE+A+ +DGR + G+ +RV++A Sbjct: 65 RNPPGFAFCIFDDRRDAEDAVRELDGRYICGQRVRVELA 103 >SB_11683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/39 (48%), Positives = 27/39 (69%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 R GFAF F +RRDAE+A+ +DGR + G+ RV++A Sbjct: 35 RNPPGFAFCVFEDRRDAEDAVRELDGRYICGQRARVELA 73 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 SRGFA+V + + + E+AL MDG +DG+E+ VQ Sbjct: 1197 SRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQ 1231 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/40 (45%), Positives = 25/40 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T RGF FV F + + E+A+D DG+ LDGR ++V A Sbjct: 133 TGRPRGFGFVTFGSKEEMEKAIDEFDGQDLDGRPMKVNEA 172 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T RGF FV F + + E+A+D DG+ DGR ++V A Sbjct: 41 TGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQA 80 >SB_59562| Best HMM Match : RRM_1 (HMM E-Value=6.1e-23) Length = 201 Score = 36.7 bits (81), Expect = 0.016 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 R GFAFV + + RDAEEA+ +DG + R +RV+ + Sbjct: 37 RNPPGFAFVEYEDYRDAEEAVRELDGANVCDRTIRVEFS 75 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +T +S+GFAF+ F R DA A++ + G D L V+ A Sbjct: 217 FTNQSKGFAFINFVHREDAARAIEVLSGFGYDHLILNVEWA 257 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/40 (37%), Positives = 27/40 (67%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 TRESRG AF+ F +R+ A+ A+ ++ + + GR ++ +A Sbjct: 47 TRESRGVAFILFIDRQSAQNAVAAVNKKQMFGRTIKCTIA 86 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 161 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 256 V NL Y T DL +VFER G+V + I RD+ Sbjct: 14 VGNLPYSLTNSDLHKVFERYGKVVKVTILRDK 45 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +1 Query: 277 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 FAFV F + RDAE+A+ DG DG +RV+ Sbjct: 302 FAFVEFEDPRDAEDAVKGRDGHEFDGYRIRVE 333 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 35.5 bits (78), Expect = 0.037 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 ESRGF FV + + A++ L M G +DGR++R+ A Sbjct: 325 ESRGFGFVDYDDVETAKKVLSEMAGAEVDGRQVRLDFA 362 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 35.5 bits (78), Expect = 0.037 Identities = 16/39 (41%), Positives = 25/39 (64%) Frame = +1 Query: 253 SYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 S T S+G+ FV+F E A+ A++ M+G L GR L++ Sbjct: 277 SETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 315 >SB_52333| Best HMM Match : RRM_1 (HMM E-Value=2.3e-16) Length = 76 Score = 35.1 bits (77), Expect = 0.049 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +1 Query: 241 HSQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 + Q R+ R + FV F +R A +A+D ++G +DG +L V +A Sbjct: 25 YGQIEKVRKIRDYGFVYFAKRESAVQAIDGINGAYIDGCKLEVSLA 70 >SB_44114| Best HMM Match : RRM_1 (HMM E-Value=9.9e-35) Length = 929 Score = 35.1 bits (77), Expect = 0.049 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 RG+ FV F + RDAE+A+ ++GR L G + V+ + Sbjct: 722 RGYGFVEFDDHRDAEDAVHDLNGRDLIGERVVVEFS 757 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 35.1 bits (77), Expect = 0.049 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 SRGF FV F DA+ A+ +++G+ + GR L++ Sbjct: 98 SRGFGFVTFANPEDAQTAVKSLNGKEVQGRTLKI 131 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 34.3 bits (75), Expect = 0.085 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T + RGF FV F D A+D M+ L GR +RV +A Sbjct: 42 TSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLA 81 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 34.3 bits (75), Expect = 0.085 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGREL 363 +S+GF FV F +AEEA++ ++G+ + GR L Sbjct: 147 KSKGFGFVSFETPEEAEEAVNVLNGKEIGGRRL 179 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+GF FV F +A +A+ M+GR+L + L V +A Sbjct: 251 SKGFGFVCFSSPEEATKAVTEMNGRILISKPLYVALA 287 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 34.3 bits (75), Expect = 0.085 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +S+GF FV F R DA +A+ MD + G++++ A Sbjct: 552 KSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWA 589 >SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 253 SYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 S + RG+AF+ + RD A DG+ +DGR + V + Sbjct: 41 SKASKPRGYAFIEYEHERDMHAAYKHADGKKIDGRRIVVDV 81 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.7 bits (71), Expect = 0.26 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 ++ + +AFV F ER A +A++ DG+ +DG ++ +A Sbjct: 359 KKLKDYAFVHFTERDHALKAIEETDGKEMDGLKIEASLA 397 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 32.7 bits (71), Expect = 0.26 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +1 Query: 247 QRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +R SRGF FV + D E+ DG +GR L+V A Sbjct: 75 EREQPERSRGFGFVTLENQEDLEDVTRKFDGFEYEGRRLKVAEA 118 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 32.3 bits (70), Expect = 0.34 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDT---MDGRMLDGR 357 TR SRGF FVRF + DA+ L T + GR+ + R Sbjct: 152 TRRSRGFGFVRFKKDEDAKNVLSTSHRIQGRLCEVR 187 Score = 31.1 bits (67), Expect = 0.80 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 122 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR 250 RP ++ L V L TT + L F + GEV D+YIP+ Sbjct: 190 RPKEELNVPKKLFVGRLPESTTEKTLMEYFAQFGEVTDVYIPK 232 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 SRGFAFV + +AE+ +GR ++G +RV Sbjct: 246 SRGFAFVDYATAEEAEKGQRAHNGRQVEGSNIRV 279 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 E RG FVRF +R +A+ A+D ++ + L G +++ Sbjct: 151 EGRGTGFVRFDKRCEAQTAIDDLNNKTLPGTNVKL 185 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +S G+AFV + DA +A+ M+G L + L+V A Sbjct: 64 TGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFA 103 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 140 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQG 265 D S+ + NL + E LR +F CG V + + RDR G Sbjct: 53 DHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTG 94 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.1 bits (67), Expect = 0.80 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 253 SYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S T S+GFAF+ F ++ A++ M+G+ L R + V A Sbjct: 136 SDTGNSKGFAFINFASFDASDAAIEAMNGQYLCNRPITVSYA 177 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = +2 Query: 155 LKVDNLTYRTTPEDLRRVFERCGEVGDI 238 L V +L + TT ++LR FE+CGE+ I Sbjct: 238 LMVQDLDFDTTVDELREYFEKCGELTGI 265 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 +L VDNL+ T D+ R F G+V ++I DR GK Sbjct: 320 TLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGK 358 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 GF FV F +A +A + ++G ++DGR++ V + Sbjct: 125 GFGFVTFNTAAEANKAREKLNGTIVDGRKVEVSL 158 >SB_42066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = +2 Query: 149 VSLKVDNLTYR--TTPEDLRRVFERCGEVGDI-YIPRDR 256 +S+K +N R T E+L +FE CG+V D ++P+DR Sbjct: 147 LSVKYNNDKTRESVTEEELTSMFEDCGDVADFRFLPKDR 185 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 +GFAFV + A+ AL+ M+G +L GR ++V Sbjct: 143 KGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKV 175 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 140 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 D + L V L+Y TT E L+ F + GE+ + I D G+ Sbjct: 26 DDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGR 68 >SB_52029| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 462 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 ++S+G V+F +A A++ + G+ML R LRV+M Sbjct: 222 KKSKGMGTVQFETPMEAMNAVNLLHGKMLMDRALRVRM 259 >SB_35194| Best HMM Match : EGF_2 (HMM E-Value=0) Length = 960 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -1 Query: 490 GNGCGYDCASXYDGGNETWTCACDRNDSCMAMRG 389 GN C C + G N C C N +C A+ G Sbjct: 652 GNACDRPCPAGKHGANCGLKCLCANNGTCNAITG 685 >SB_8144| Best HMM Match : VWA (HMM E-Value=3.1e-16) Length = 193 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = -1 Query: 424 CDRNDSCMAMRGDHIAPSEREVP--CRPTFVRPSCP 323 C+ +D C G+ P E E P CR T + SCP Sbjct: 27 CNSDDKCSP--GERCRPQENECPLKCRKTIKKKSCP 60 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.5 bits (63), Expect = 2.4 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 + + +GF F+R R AE A +D GR LRV+ A Sbjct: 82 FINKEKGFGFIRLDTRLHAEAAKAGLDMATRKGRTLRVRFA 122 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T + +G+ F + ++ A A+ ++G L+GR LRV A Sbjct: 62 TGKPKGYGFCEYKDQETALSAMRNLNGYELNGRALRVDSA 101 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPR 250 +L V N+ TT DL+ FER GEV D+ I + Sbjct: 250 TLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKK 282 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGR 342 T+E+RG +V+F + A A + MDGR Sbjct: 60 TKENRGVCYVKFVKASSAALACEEMDGR 87 >SB_41292| Best HMM Match : RRM_1 (HMM E-Value=0.0085) Length = 292 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 1/35 (2%) Frame = +1 Query: 277 FAFVRFFERRDAEEALDTMDGR-MLDGRELRVQMA 378 +AFV+F+ + A A + ++G+ ++DG L+VQ A Sbjct: 80 YAFVKFYSAKAALRAKEEVNGKWLIDGNILKVQFA 114 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 244 SQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 366 S+ + S+G+AFV F A+ A DTM M+ GR L+ Sbjct: 130 SRSKKSARSKGYAFVEFACDEVAKIAADTMHNYMMFGRLLK 170 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 ++ +G + F +RD + AL +DG L+G+ +R+ Sbjct: 130 KQRQGEGVIEFSCKRDLKRALKKLDGEELNGKRIRL 165 >SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -1 Query: 457 YDGGNETWTCACD---RNDSCMAMRGDHIAPSEREVPCR 350 YDG T D ND + M G H AP R++ C+ Sbjct: 332 YDGDRNTQIALMDMPHENDVVVEMNGRHAAPRHRKIRCQ 370 >SB_43406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +1 Query: 241 HSQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 H +R ++R FV F A++A+D M+G + +RV MA Sbjct: 133 HVERVNFEKNRSQGFVTFDTWEAADKAIDEMNGLKVQHVHIRVSMA 178 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 S GF FV + DA++A+D ++G + + L+V Sbjct: 87 SYGFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKV 120 >SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15) Length = 876 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 277 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 F FV+F + A+EA+ GR+++G+++ V++ Sbjct: 82 FGFVQFETEKGADEAVAKEHGRIINGKKIDVRI 114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,661,416 Number of Sequences: 59808 Number of extensions: 342073 Number of successful extensions: 888 Number of sequences better than 10.0: 46 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 884 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -