BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120790.seq (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 51 8e-07 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 51 8e-07 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 45 4e-05 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 44 9e-05 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 43 2e-04 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 42 5e-04 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 42 5e-04 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 42 5e-04 At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing ... 41 6e-04 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 41 8e-04 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 41 8e-04 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 41 8e-04 At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR... 41 8e-04 At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR... 41 8e-04 At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR... 41 8e-04 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 40 0.002 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 40 0.002 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 40 0.002 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 40 0.002 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 40 0.002 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 39 0.002 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 39 0.002 At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR... 39 0.003 At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR... 39 0.003 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 39 0.003 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 38 0.004 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 38 0.004 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 38 0.004 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 38 0.006 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 38 0.006 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 38 0.006 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 38 0.006 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 38 0.007 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 38 0.007 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 37 0.010 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 37 0.010 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 37 0.013 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 37 0.013 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 37 0.013 At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative stro... 37 0.013 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 37 0.013 At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30)... 37 0.013 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 36 0.017 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 36 0.023 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 36 0.023 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 36 0.023 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 36 0.023 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 36 0.023 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 36 0.030 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 36 0.030 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 36 0.030 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 36 0.030 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 35 0.040 At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly id... 35 0.040 At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly id... 35 0.040 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 35 0.040 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 35 0.040 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 35 0.040 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 35 0.040 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 35 0.053 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 35 0.053 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 35 0.053 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 35 0.053 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 34 0.070 At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein... 34 0.070 At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein... 34 0.070 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 34 0.070 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 34 0.092 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 34 0.092 At2g47310.1 68415.m05906 flowering time control protein-related ... 34 0.092 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 34 0.092 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 33 0.12 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 33 0.12 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 33 0.16 At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonu... 33 0.16 At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonu... 33 0.16 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 33 0.16 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 33 0.16 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 33 0.21 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 33 0.21 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 32 0.28 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 32 0.28 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 32 0.28 At5g51120.1 68418.m06339 polyadenylate-binding protein, putative... 32 0.37 At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing ... 32 0.37 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 32 0.37 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 32 0.37 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 32 0.37 At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing ... 31 0.49 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 31 0.49 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 31 0.49 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 31 0.49 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 31 0.49 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 31 0.49 At5g51300.2 68418.m06360 splicing factor-related contains simila... 31 0.65 At5g51300.1 68418.m06359 splicing factor-related contains simila... 31 0.65 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 0.65 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.65 At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing ... 31 0.65 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 31 0.65 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 31 0.65 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 31 0.86 At5g65260.1 68418.m08209 polyadenylate-binding protein family pr... 30 1.1 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 30 1.1 At5g10350.2 68418.m01201 polyadenylate-binding protein family pr... 30 1.1 At5g10350.1 68418.m01200 polyadenylate-binding protein family pr... 30 1.1 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 30 1.1 At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, ... 30 1.1 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 30 1.1 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 30 1.1 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 30 1.5 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 30 1.5 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 30 1.5 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 30 1.5 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 30 1.5 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 29 2.0 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 29 2.0 At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RS... 29 2.0 At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p... 29 2.0 At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p... 29 2.0 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 29 2.0 At1g30680.1 68414.m03751 toprim domain-containing protein contai... 29 2.0 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 2.0 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 29 2.6 At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing ... 29 2.6 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 29 2.6 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 29 2.6 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 29 3.5 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 4.6 At3g53830.1 68416.m05947 regulator of chromosome condensation (R... 28 4.6 At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identic... 28 4.6 At5g03480.1 68418.m00304 expressed protein ; expression support... 28 6.1 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 28 6.1 At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RS... 28 6.1 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 28 6.1 At3g50180.1 68416.m05486 hypothetical protein 28 6.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 28 6.1 At2g24590.1 68415.m02936 splicing factor, putative similar to to... 28 6.1 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 28 6.1 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 28 6.1 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 27 8.0 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 27 8.0 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 27 8.0 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 27 8.0 At5g03500.1 68418.m00306 transcriptional co-activator-related lo... 27 8.0 At4g22540.1 68417.m03253 oxysterol-binding family protein simila... 27 8.0 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 27 8.0 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 27 8.0 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 27 8.0 At1g07600.1 68414.m00813 metallothionein-like protein 1A (MT-1A)... 27 8.0 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = +2 Query: 116 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQG 265 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR G Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTG 54 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/40 (52%), Positives = 32/40 (80%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ A Sbjct: 53 TGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFA 92 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 50.8 bits (116), Expect = 8e-07 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = +2 Query: 116 YGRP-PPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQG 265 +GR PP I SL V N+T+RTT +DL +F + G+V D++IPRDR G Sbjct: 4 FGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTG 54 Score = 49.6 bits (113), Expect = 2e-06 Identities = 21/40 (52%), Positives = 32/40 (80%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +SRGFAFVR+ + +A +A++ +DGR++DGRE+ VQ A Sbjct: 53 TGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFA 92 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 45.2 bits (102), Expect = 4e-05 Identities = 20/41 (48%), Positives = 30/41 (73%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +TR+SRG AFV + R DA +A +MD ++L+GR+L V +A Sbjct: 93 HTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIA 133 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 44.0 bits (99), Expect = 9e-05 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 YT + RGF F++F + DA EA MDG +L GREL V A Sbjct: 73 YTGDPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFA 113 Score = 41.1 bits (92), Expect = 6e-04 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQG 265 SL V NL + EDLRR FE+ G V DIY+PRD G Sbjct: 38 SLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTG 75 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 YT + RGF FV+F + DA +A MDG +L GREL V A Sbjct: 72 YTGDPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFA 112 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/38 (52%), Positives = 24/38 (63%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQG 265 SL V NL + EDLR+ FE+ G V DIY+PRD G Sbjct: 37 SLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTG 74 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 41.5 bits (93), Expect = 5e-04 Identities = 18/40 (45%), Positives = 26/40 (65%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 YT SRGF FV + +AE A+ MDG+ L+GR + V++ Sbjct: 39 YTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVKL 78 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 SL V N+ PE+LR FER G V D+YIPRD G+ Sbjct: 48 SLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQ 86 Score = 38.7 bits (86), Expect = 0.003 Identities = 19/41 (46%), Positives = 26/41 (63%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 Y+ + RGFAFV F + DA EA +M+ R GRE+ V +A Sbjct: 83 YSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVA 123 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/37 (56%), Positives = 23/37 (62%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV F E DA A D MDG+ L GR LR+ A Sbjct: 81 SRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFA 117 >At1g13690.1 68414.m01609 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 177 Score = 41.1 bits (92), Expect = 6e-04 Identities = 20/39 (51%), Positives = 23/39 (58%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 ++ R F FV F ER DA A+D MDG L GR L V A Sbjct: 51 QKHRSFGFVTFLEREDASAAMDNMDGAELYGRVLTVNYA 89 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 40.7 bits (91), Expect = 8e-04 Identities = 17/42 (40%), Positives = 29/42 (69%) Frame = +1 Query: 253 SYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S T+ +GF F+ F DA +AL ++DG+++DGR + V++A Sbjct: 42 SETQRPKGFGFITFDSEDDARKALKSLDGKIVDGRLIFVEVA 83 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 40.7 bits (91), Expect = 8e-04 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F A A+ MDG+ L+GR++RV +A Sbjct: 72 TGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 40.7 bits (91), Expect = 8e-04 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F A A+ MDG+ L+GR++RV +A Sbjct: 72 TGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVNLA 111 >At1g02840.3 68414.m00246 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 40.7 bits (91), Expect = 8e-04 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 G+AFV F + RDAE+A+ DG DG LRV++A Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 >At1g02840.2 68414.m00244 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 285 Score = 40.7 bits (91), Expect = 8e-04 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 G+AFV F + RDAE+A+ DG DG LRV++A Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 >At1g02840.1 68414.m00245 pre-mRNA splicing factor SF2 (SF2) / SR1 protein identical to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 303 Score = 40.7 bits (91), Expect = 8e-04 Identities = 18/35 (51%), Positives = 24/35 (68%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 G+AFV F + RDAE+A+ DG DG LRV++A Sbjct: 46 GYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELA 80 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 YT E RGF FV++ DA EA+ M+ +++ GRE+ + A Sbjct: 83 YTGEPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAIVFA 123 Score = 36.3 bits (80), Expect = 0.017 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = +2 Query: 143 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 G L + NL P DLR FER G + DIY+PR+ G+ Sbjct: 45 GPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGE 86 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F + A A+ MDG+ L+GR +RV A Sbjct: 72 TGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F + A A+ MDG+ L+GR +RV A Sbjct: 72 TGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPA 111 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F ++DA+ A++ M+G+ L R++R A Sbjct: 181 TGRSRGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWA 220 Score = 33.9 bits (74), Expect = 0.092 Identities = 16/59 (27%), Positives = 33/59 (55%) Frame = +1 Query: 202 PRFRKVRRSW*YLHSQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 P +++ S + S + ++ + FV +F+RR A A+ +++GR L G+ ++V A Sbjct: 73 PLLQEIFTSTGPVESSKLIRKDKSSYGFVHYFDRRSAALAILSLNGRHLFGQPIKVNWA 131 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 39.5 bits (88), Expect = 0.002 Identities = 17/40 (42%), Positives = 27/40 (67%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRG+ FV + + + E AL+++DG L+GR +RV +A Sbjct: 214 TGRSRGYGFVCYSSKAEMETALESLDGFELEGRAIRVNLA 253 Score = 33.9 bits (74), Expect = 0.092 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +SRGFAFV D +D +DG GR L+V A Sbjct: 122 TGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFA 161 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/39 (41%), Positives = 28/39 (71%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 + S+G+AF++F + DA A++TMD RM +GR + + +A Sbjct: 78 KRSKGYAFIQFTSQDDAFLAIETMDRRMYNGRMIYIDIA 116 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 ++ SRGF F+ F E++ +EA+ M+G LDGR + V A Sbjct: 43 FSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKA 83 >At4g02430.2 68417.m00330 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 278 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 G+AFV F + RDA++A+ DG DG LRV++A Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 >At4g02430.1 68417.m00329 pre-mRNA splicing factor, putative / SR1 protein, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana}; cDNA NCBI_gi:15810292 supports a truncated version while protein evidence supports a longer model. Length = 178 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 G+AFV F + RDA++A+ DG DG LRV++A Sbjct: 46 GYAFVEFEDARDADDAIYGRDGYDFDGHHLRVELA 80 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 38.7 bits (86), Expect = 0.003 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F ++DA+ A+D + G+ L R++R A Sbjct: 176 TGRSRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIRCNWA 215 Score = 33.1 bits (72), Expect = 0.16 Identities = 14/39 (35%), Positives = 25/39 (64%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +E + FV +F+RR A A+ +++GR L G+ ++V A Sbjct: 88 KEKSSYGFVHYFDRRSAGLAILSLNGRHLFGQPIKVNWA 126 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 38.3 bits (85), Expect = 0.004 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV + + EA+ +DG+ L+GR +RV +A Sbjct: 281 TGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVA 320 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +SRGF FV +AE A++ + L+GR L V A Sbjct: 187 TDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKA 226 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F ++DA+ A++ M+G+ + R++R A Sbjct: 189 TGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWA 228 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +1 Query: 238 LHSQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 + S + ++ + FV +F+RR A A+ T++GR + G+ ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 38.3 bits (85), Expect = 0.004 Identities = 16/40 (40%), Positives = 26/40 (65%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F ++DA+ A++ M+G+ + R++R A Sbjct: 185 TGRSRGFGFVSFRNQQDAQTAINEMNGKWVSSRQIRCNWA 224 Score = 33.5 bits (73), Expect = 0.12 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +1 Query: 238 LHSQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 + S + ++ + FV +F+RR A A+ T++GR + G+ ++V A Sbjct: 89 IESCKLIRKDKSSYGFVHYFDRRCASMAIMTLNGRHIFGQPMKVNWA 135 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 37.9 bits (84), Expect = 0.006 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 TR+S G+ +V F + DA+ A++ M+G+ DGR + V+ Sbjct: 114 TRQSLGYGYVWFNSKEDAQSAVEAMNGKFFDGRFILVK 151 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF F+ F + + AL TM+G ++GR LR+ +A Sbjct: 256 TGRSRGFGFISFESAENVQSALATMNGVEVEGRALRLNLA 295 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T SRGF FV +A+EA+ + + GR ++V Sbjct: 153 TDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F + + ++A++ M+G+ LDGR + V A Sbjct: 45 TGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEA 84 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.9 bits (84), Expect = 0.006 Identities = 17/40 (42%), Positives = 26/40 (65%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F + + ++A++ M+G+ LDGR + V A Sbjct: 45 TGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEA 84 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 37.5 bits (83), Expect = 0.007 Identities = 17/36 (47%), Positives = 24/36 (66%) Frame = +2 Query: 161 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 V NLT+RTT +DLRR FE+ G+V D + + G+ Sbjct: 16 VGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGR 51 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 37.5 bits (83), Expect = 0.007 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+GF FV + ++ + A+ ++DG LDGR++RV A Sbjct: 244 SKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEA 280 Score = 32.7 bits (71), Expect = 0.21 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T SRGF FV + E A +G LDGR LRV Sbjct: 128 TGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRV 164 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 37.1 bits (82), Expect = 0.010 Identities = 18/40 (45%), Positives = 22/40 (55%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F A A+ +DGR L GR ++V A Sbjct: 77 TGRSRGFGFVTFTSSEAASSAIQALDGRDLHGRVVKVNYA 116 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 37.1 bits (82), Expect = 0.010 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV F R DA+ A++ ++G D LRV+ A Sbjct: 250 TGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWA 289 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV F + + +A++ M+G+ LDGR + V A Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEA 82 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 161 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV F + + +A++ M+G+ LDGR + V A Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEA 82 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 161 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 36.7 bits (81), Expect = 0.013 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV F + + +A++ M+G+ LDGR + V A Sbjct: 46 SRGFGFVTFKDEKAMRDAIEEMNGKELDGRVITVNEA 82 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 161 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At3g49430.1 68416.m05403 pre-mRNA splicing factor, putative strong similarity to SP|O22315 Pre-mRNA splicing factor SF2 (SR1 protein) {Arabidopsis thaliana} Length = 300 Score = 36.7 bits (81), Expect = 0.013 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +1 Query: 277 FAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 + FV F RDAE+A+ DG LDG LRV++A Sbjct: 47 YCFVEFEHSRDAEDAIKGRDGYNLDGCRLRVELA 80 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 36.7 bits (81), Expect = 0.013 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGFAFV F +A A+ +DG+ L GR +RV A Sbjct: 71 TGRSRGFAFVTFTSTEEASNAMQ-LDGQDLHGRRIRVNYA 109 >At1g09140.1 68414.m01018 SF2/ASF-like splicing modulator (SRP30) nearly identical to SF2/ASF-like splicing modulator Srp30 [Arabidopsis thaliana] GI:4775270 Length = 268 Score = 36.7 bits (81), Expect = 0.013 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 G+AFV F + RDA++A+ DG DG LRV++A Sbjct: 46 GYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIA 80 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 36.3 bits (80), Expect = 0.017 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +2 Query: 131 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQG 265 P+ + +L V L+ RTT E LR F + GEV D + DR G Sbjct: 50 PQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSG 94 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDG 354 S+GF FVR+ D+ + + MDG+ LDG Sbjct: 96 SKGFGFVRYATLEDSAKGIAGMDGKFLDG 124 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 35.9 bits (79), Expect = 0.023 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF FV+ + A+ +DG+ L+GR ++V +A Sbjct: 244 TGRSRGFGFVQMSNENEVNVAIAALDGQNLEGRAIKVNVA 283 Score = 30.7 bits (66), Expect = 0.86 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +SRGF FV +AE+A++ + ++GR L V A Sbjct: 150 TDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRA 189 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 35.9 bits (79), Expect = 0.023 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 T SRGF FV F R DA+ A++ ++G D LRV+ Sbjct: 211 TSMSRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVE 248 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 35.9 bits (79), Expect = 0.023 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+GF FV ++ ++A+++++G LDGR++RV A Sbjct: 289 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 325 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T SRGF FV + E A +G +GR LRV Sbjct: 136 TGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRV 172 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 35.9 bits (79), Expect = 0.023 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+GF FV ++ ++A+++++G LDGR++RV A Sbjct: 297 SKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEA 333 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T SRGF FV + E A +G +GR LRV Sbjct: 136 TGRSRGFGFVTMSTAAEVEAAAQQFNGYEFEGRPLRV 172 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 35.9 bits (79), Expect = 0.023 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 T S+GF FV F + A+D M+G+ LDGR + Q Sbjct: 81 TGRSKGFRFVTFKDEDSMRTAIDRMNGQELDGRNITAQ 118 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 35.5 bits (78), Expect = 0.030 Identities = 14/40 (35%), Positives = 27/40 (67%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T+ +GF F+ F DA++AL ++G++++GR + V+ A Sbjct: 103 TQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 35.5 bits (78), Expect = 0.030 Identities = 16/39 (41%), Positives = 26/39 (66%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 T S+ F FV + + A+ A+D M+GR L G++L+VQ+ Sbjct: 386 TGVSKCFGFVSYDSQAAAQNAIDMMNGRHLGGKKLKVQL 424 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 35.5 bits (78), Expect = 0.030 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +S GF FV F D E A+ ++ +L+G+++RV A Sbjct: 214 TSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 Y+ SR F F DA ++ ++G ++GRE++V + Sbjct: 112 YSGRSRRFGFATMKSVEDANAVVEKLNGNTVEGREIKVNI 151 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 35.5 bits (78), Expect = 0.030 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +TRESRGF F+ DA + ++D +L GR + V+ A Sbjct: 111 WTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKA 151 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 35.1 bits (77), Expect = 0.040 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +1 Query: 253 SYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S T S+G+ FVRF + + AL M+G R++RV +A Sbjct: 238 SNTGRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIA 279 >At2g37340.3 68415.m04580 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 249 Score = 35.1 bits (77), Expect = 0.040 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 R +AFV F + RDA++A +DGR DG + V+ + Sbjct: 3 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFS 38 >At2g37340.1 68415.m04581 splicing factor RSZ33 (RSZ33) nearly identical to splicing factor RSZ33 [Arabidopsis thaliana] GI:9843663; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00098: Zinc knuckle Length = 290 Score = 35.1 bits (77), Expect = 0.040 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 R +AFV F + RDA++A +DGR DG + V+ + Sbjct: 44 RDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFS 79 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 35.1 bits (77), Expect = 0.040 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 E RGFAFV+F + D A++ +G + GR + V+ A Sbjct: 59 EHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQA 96 Score = 31.5 bits (68), Expect = 0.49 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 155 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQG 265 L + NL ++ P D++ VF G V D++IP++ G Sbjct: 333 LIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETG 369 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +GFAFV+F ++DA A+ +G M R + V A Sbjct: 372 KGFAFVKFTCKKDAANAIKKFNGHMFGKRPIAVDWA 407 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 35.1 bits (77), Expect = 0.040 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = +2 Query: 131 PRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRT 259 P G L V NL + +DLR+VFE G V + +PRD T Sbjct: 279 PYSGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRDET 321 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 35.1 bits (77), Expect = 0.040 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 49 TGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 35.1 bits (77), Expect = 0.040 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T RGF F+ F +RR A++A+ M GR L + + V A Sbjct: 49 TGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKA 88 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 34.7 bits (76), Expect = 0.053 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLD--GRELRVQMA 378 +T SRGFAFV F+ DA +AL+ + L+ G+ LRV A Sbjct: 494 FTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYA 536 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 34.7 bits (76), Expect = 0.053 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 T + +G+AF+ + RD + A DG+ +DGR + V + Sbjct: 175 TNKPKGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVDV 213 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 34.7 bits (76), Expect = 0.053 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +GFAF+R+ +A +A+ M G+ LDGR + V+ A Sbjct: 118 KGFAFLRYETEEEAMKAIQGMHGKFLDGRVIFVEEA 153 Score = 28.3 bits (60), Expect = 4.6 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +2 Query: 95 SILFKMSYGRPPPRIDG-MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 S L S PP G L V L++RTT + LR FE+ G + + + D+ + Sbjct: 58 SCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANR 116 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 34.7 bits (76), Expect = 0.053 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 253 SYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S T S+G+ FVRF + + A+ M+G R++RV +A Sbjct: 249 SNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIA 290 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 34.3 bits (75), Expect = 0.070 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +1 Query: 250 RSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 + + ESRGFAF+ F A A+ MDGR++ + L VQ Sbjct: 50 KDFRGESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQ 90 >At3g53500.2 68416.m05907 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 284 Score = 34.3 bits (75), Expect = 0.070 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 R +AFV F + RDA++A +DGR DG + V+ Sbjct: 44 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVE 77 >At3g53500.1 68416.m05906 zinc knuckle (CCHC-type) family protein contains Pfam domain PF00098: Zinc knuckle Length = 243 Score = 34.3 bits (75), Expect = 0.070 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 R +AFV F + RDA++A +DGR DG + V+ Sbjct: 3 RDYAFVEFSDPRDADDARYYLDGRDFDGSRITVE 36 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 34.3 bits (75), Expect = 0.070 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 256 YTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 +TRESRGF F+ DA + ++D +L GR + V+ Sbjct: 81 WTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVE 119 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 33.9 bits (74), Expect = 0.092 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRG+ FV F A A+ M+G+ L+G + V +A Sbjct: 68 TGRSRGYGFVNFISEDSANSAISAMNGQELNGFNISVNVA 107 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 33.9 bits (74), Expect = 0.092 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +2 Query: 116 YGRPPPRIDGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRD 253 YGR P G+ + + V L + +DLR F R G + D YIP+D Sbjct: 228 YGRGEPTTRGIGNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKD 274 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 194 DLRRVFERCGEVGDIYIPRD 253 D R FER GE+ D+Y+P+D Sbjct: 106 DFRSHFERYGEITDLYMPKD 125 >At2g47310.1 68415.m05906 flowering time control protein-related / FCA gamma-related Length = 512 Score = 33.9 bits (74), Expect = 0.092 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +2 Query: 140 DGMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 DG ++ L V ++ T D+R+VFE+ G V +I +P+D+ G+ Sbjct: 106 DGSIAKLYVAPISKTATEYDIRQVFEKYGNVTEIILPKDKMTGE 149 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 33.9 bits (74), Expect = 0.092 Identities = 13/32 (40%), Positives = 23/32 (71%) Frame = +1 Query: 283 FVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 FV FF+ RDA +AL M+G+++ G+ + +Q + Sbjct: 223 FVEFFDVRDAAKALRVMNGKVISGKPMVIQFS 254 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 33.5 bits (73), Expect = 0.12 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF F+ F +RR +E++ M GR R + V A Sbjct: 44 TGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRA 83 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 33.5 bits (73), Expect = 0.12 Identities = 15/54 (27%), Positives = 29/54 (53%) Frame = +2 Query: 107 KMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 K S G P +DG + + NL + TT D+R++F C + + + +++ G+ Sbjct: 248 KTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRKLFSDC-VINSVRLGKNKETGE 300 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 33.1 bits (72), Expect = 0.16 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 113 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGKVE 274 +Y PP ++ V NL T E+L++ F + GEV + IP + G V+ Sbjct: 225 AYVAPPESDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIPATKGYGYVQ 278 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T S+G+ FV+F E + A+ M+G R +R+ A Sbjct: 154 TGRSKGYGFVKFAEESERNRAMAEMNGLYCSTRPMRISAA 193 >At4g35785.2 68417.m05083 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 141 Score = 33.1 bits (72), Expect = 0.16 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 357 TR SRGFAFV +DAE + ++ +L+GR Sbjct: 109 TRVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 141 >At4g35785.1 68417.m05082 transformer serine/arginine-rich ribonucleoprotein, putative similar to transformer-SR ribonucleoprotein [Nicotiana tabacum] gi|1781299|emb|CAA70700 Length = 140 Score = 33.1 bits (72), Expect = 0.16 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGR 357 TR SRGFAFV +DAE + ++ +L+GR Sbjct: 108 TRVSRGFAFVTMSSLKDAERCIKYLNQSVLEGR 140 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 S+ F F+ + + A+ A++TM+G L G++L+VQ+ Sbjct: 379 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQL 414 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 33.1 bits (72), Expect = 0.16 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 S+ F F+ + + A+ A++TM+G L G++L+VQ+ Sbjct: 370 SKCFGFISYDSQAAAQNAINTMNGCQLSGKKLKVQL 405 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/36 (36%), Positives = 25/36 (69%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 ++RGF V +++ R A++A + GR+L GR+L ++ Sbjct: 245 KNRGFIMVSYYDIRAAQKAARALHGRLLRGRKLDIR 280 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRE 360 +S+GF FV F DA A+D ++G+ D +E Sbjct: 262 KSKGFGFVNFENSDDAARAVDALNGKTFDDKE 293 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRG FV F +A A+ M+G+M+ + L V +A Sbjct: 366 SRGSGFVAFSTPEEATRAITEMNGKMIVTKPLYVALA 402 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/35 (28%), Positives = 24/35 (68%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 +S+G+ FV++ A+ A+D ++G +L+ +++ V Sbjct: 171 QSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYV 205 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 32.3 bits (70), Expect = 0.28 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+GF FV F +A++AL +G+ L+GR + V A Sbjct: 74 SKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYA 110 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 32.3 bits (70), Expect = 0.28 Identities = 13/37 (35%), Positives = 26/37 (70%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T +S+GFAF+ + ++R A+D ++G ++ GR ++V Sbjct: 73 TGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKV 109 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 161 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 V + + T DL VF + GE+ D+ + RD+ GK Sbjct: 40 VGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGK 75 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 32.3 bits (70), Expect = 0.28 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +1 Query: 244 SQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQ 372 S+ T ESRG +V A+ A+ ++DG + GRE+RV+ Sbjct: 140 SRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVR 182 >At5g51120.1 68418.m06339 polyadenylate-binding protein, putative / PABP, putative contains similarity to poly(A)-binding protein II [Mus musculus] GI:2351846; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 227 Score = 31.9 bits (69), Expect = 0.37 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 256 S+ V N+ Y TPE++++ F+ CG V + I D+ Sbjct: 104 SIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTDK 138 >At5g16260.1 68418.m01899 RNA recognition motif (RRM)-containing protein similar to Tat-SF1 - Homo sapiens, GI:1667611; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 519 Score = 31.9 bits (69), Expect = 0.37 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 +G VRF +RRDA++ ++ M+GR R++ + Sbjct: 454 QGVVLVRFKDRRDAQKCIEAMNGRWYAKRQIHASL 488 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 31.9 bits (69), Expect = 0.37 Identities = 12/29 (41%), Positives = 22/29 (75%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGR 357 +GFA+V F + +AE+AL ++ +++DGR Sbjct: 62 KGFAYVTFSSKEEAEKALLELNAQLVDGR 90 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 31.9 bits (69), Expect = 0.37 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 113 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 SY R P + V L + T +++RR FE+ GE+ + I D+ GK Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 31.9 bits (69), Expect = 0.37 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 113 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 SY R P + V L + T +++RR FE+ GE+ + I D+ GK Sbjct: 5 SYYRSPFGDTTYTKVFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGK 56 >At4g12640.1 68417.m01989 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 823 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 R +AFV F DA A++++ G L G LR++ A Sbjct: 58 RSYAFVNFNHDEDAFAAIESLQGFPLSGNPLRIEFA 93 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 31.5 bits (68), Expect = 0.49 Identities = 11/32 (34%), Positives = 22/32 (68%) Frame = +1 Query: 283 FVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 FV F++ RDA A D M+G+ + G+++ ++ + Sbjct: 253 FVEFYDVRDAARAFDRMNGKEIGGKQVVIEFS 284 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 31.5 bits (68), Expect = 0.49 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +S+GF FV F +A +A+ T G+M G+ L V +A Sbjct: 342 KSKGFGFVCFSTPEEAIDAVKTFHGQMFHGKPLYVAIA 379 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 R RG+AFV F DA A +T++G + L V A Sbjct: 238 RLCRGYAFVNFDNPEDARRAAETVNGTKFGSKCLYVGRA 276 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV + +A AL M+G+M+ + L + +A Sbjct: 371 SRGFGFVAYSNPEEALRALSEMNGKMIGRKPLYIALA 407 Score = 31.1 bits (67), Expect = 0.65 Identities = 11/37 (29%), Positives = 25/37 (67%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T S+G+ FV+F + A+ A+D ++G +++ +++ V Sbjct: 172 TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFV 208 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELR 366 RG +V F R DAE+A MDG +DG+ ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 31.5 bits (68), Expect = 0.49 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELR 366 RG +V F R DAE+A MDG +DG+ ++ Sbjct: 139 RGHGYVEFKARADAEKAQLYMDGAQIDGKVVK 170 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.65 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+G+ FV++ + + A A+ M+G +GR L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 31.1 bits (67), Expect = 0.65 Identities = 13/37 (35%), Positives = 24/37 (64%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+G+ FV++ + + A A+ M+G +GR L V++A Sbjct: 520 SKGYGFVKYADVQMANTAVQAMNGYRFEGRTLAVRIA 556 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.1 bits (67), Expect = 0.65 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 161 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 V L + T EDL+R F + G+V D I DR G+ Sbjct: 10 VGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGR 45 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.1 bits (67), Expect = 0.65 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +S+GF FV F DA A+++++G D +E V A Sbjct: 67 KSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRA 104 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+G FV F +A EA+ + G+M++ + L V +A Sbjct: 171 SKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIA 207 >At4g09040.1 68417.m01491 RNA recognition motif (RRM)-containing protein low similarity to enhancer binding protein-1; EBP1 [Entamoeba histolytica] GI:8163877, SP|P19682 28 kDa ribonucleoprotein, chloroplast precursor (28RNP) {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 31.1 bits (67), Expect = 0.65 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = +2 Query: 155 LKVDNLTYRTTPEDLRRVFERCGEVGDIYI---PRDRTQGKV 271 L N+ + +TPED+R +FE+ G V DI + ++R +G V Sbjct: 96 LIAQNVPWTSTPEDIRSLFEKYGSVIDIEMSMHKKERNRGLV 137 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 31.1 bits (67), Expect = 0.65 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+G FV F +A L+ M+G+M+ G+ L V +A Sbjct: 367 SKGSGFVAFSAASEASRVLNEMNGKMVGGKPLYVALA 403 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.1 bits (67), Expect = 0.65 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T SRGF F+ + ++ A+++M G+ L R++ V A Sbjct: 150 TGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQITVSYA 189 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 30.7 bits (66), Expect = 0.86 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRM 345 TR+S G+ +V F + DA+ A++ M+G++ Sbjct: 95 TRQSLGYGYVWFNSKEDAQSAVEAMNGKV 123 >At5g65260.1 68418.m08209 polyadenylate-binding protein family protein / PABP family protein low similarity to poly(A)-binding protein II [Drosophila melanogaster] GI:6007612; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 220 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 256 S+ V N+ Y TPE++++ F+ CG V + I D+ Sbjct: 93 SVFVGNVDYACTPEEVQQHFQTCGTVHRVTILTDK 127 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 + +GFA+V F E +EAL + L GR+L+V Sbjct: 130 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKV 163 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T S+G+ FVRF + + A+ M+G+ R +R+ Sbjct: 192 TGRSKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRI 228 >At5g10350.2 68418.m01201 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 256 S+ V N+ Y TPE+++ F+ CG V + I D+ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDK 124 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 + +GFA+V F E +EAL + L GR+L+V Sbjct: 127 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKV 160 >At5g10350.1 68418.m01200 polyadenylate-binding protein family protein / PABP family protein contains weak similarity to poly(A) binding protein II from [Mus musculus] GI:2351846, [Xenopus laevis] GI:11527140; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 217 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDR 256 S+ V N+ Y TPE+++ F+ CG V + I D+ Sbjct: 90 SVYVGNVDYACTPEEVQLHFQTCGTVNRVTILMDK 124 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 + +GFA+V F E +EAL + L GR+L+V Sbjct: 127 QPKGFAYVEFVEVEAVQEALQLNESE-LHGRQLKV 160 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/36 (33%), Positives = 26/36 (72%) Frame = +1 Query: 271 RGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +G+ + F +A++AL+ M+G++L GR++R+ +A Sbjct: 424 KGYGHIEFASPEEAQKALE-MNGKLLLGRDVRLDLA 458 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 191 EDLRRVFERCGEVGDIYIPRDRTQG 265 ++LR F +CGEV +++P DR G Sbjct: 497 KELRSHFSKCGEVTRVHVPTDRETG 521 >At2g35410.1 68415.m04340 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to SP|P19684 33 kDa ribonucleoprotein, chloroplast precursor {Nicotiana sylvestris}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 308 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 ++RGFAFV +A+ A+D D + GR + V A Sbjct: 133 KNRGFAFVTMASGEEAQAAIDKFDTFQVSGRIISVSFA 170 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 30.3 bits (65), Expect = 1.1 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 S+G+ FV+F + A+ A+D ++G +L+ +++ V Sbjct: 171 SKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFV 204 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV + +A A+ M+G+M+ + L V +A Sbjct: 367 SRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALA 403 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 113 SYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 SY R P + V L + T +++RR F++ GE+ + I D+ GK Sbjct: 5 SYYRSPFGDTTHTKVFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGK 56 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV F +A++A++++ G L ++L V A Sbjct: 241 SRGFGFVNFCNPENAKKAMESLCGLQLGSKKLFVGKA 277 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 +S+GF FV+F + A A + G M+ G++L V Sbjct: 149 QSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFV 183 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/37 (32%), Positives = 25/37 (67%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+GF FV F ++++A ++G ++DG+ + V++A Sbjct: 343 SKGFGFVCFSNCEESKQAKRYLNGFLVDGKPIVVRVA 379 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 237 TGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 273 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 235 TGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T S+G+ FVRF + + +A+ M+G R +R+ Sbjct: 235 TGRSKGYGFVRFGDENERTKAMTEMNGVKCSSRAMRI 271 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +SR F FV F + A A++ M+G ++D +EL V A Sbjct: 157 KSRRFGFVNFEKAEAAVTAIEKMNGVVVDEKELHVGRA 194 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 S+G FV F +A +A+ M+G+M+ + + V +A Sbjct: 262 SKGVGFVEFSTSEEASKAMLKMNGKMVGNKPIYVSLA 298 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQ 372 GFAFV + RDAE+A+ +D GR GR LRV+ Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVE 70 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQ 372 GFAFV + RDAE+A+ +D GR GR LRV+ Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEYGR--TGRRLRVE 70 >At4g25500.1 68417.m03673 arginine/serine-rich splicing factor RSP40 (RSP40) identical to SP|P92965 Arginine/serine-rich splicing factor RSP40 {Arabidopsis thaliana} Length = 350 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMD----GRMLDGRELRVQ 372 GFAFV + RDAE+A+ +D GR GR LRV+ Sbjct: 36 GFAFVYMEDERDAEDAIRALDRFEFGR--KGRRLRVE 70 >At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 224 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 351 R R FAFV+F + DA +ALD T + ++LD Sbjct: 100 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 130 >At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, putative similar to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 250 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALD-TMDGRMLD 351 R R FAFV+F + DA +ALD T + ++LD Sbjct: 126 RMRRNFAFVQFATQEDATKALDSTHNSKLLD 156 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDG 354 S+GF FV + DAE+A M+ + LDG Sbjct: 74 SKGFGFVTYATIEDAEKAKAEMNAKFLDG 102 >At1g30680.1 68414.m03751 toprim domain-containing protein contains Pfam profile: PF01751 toprim domain Length = 709 Score = 29.5 bits (63), Expect = 2.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +2 Query: 221 GEVGDIYIPRDRTQGKVEDSP 283 G++GD Y+ DRT G DSP Sbjct: 675 GQIGDAYLCYDRTTGSYSDSP 695 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +1 Query: 268 SRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 SRGF FV + A A+ M + LDGR + V A Sbjct: 76 SRGFGFVTYDSIEVANNAMQAMQNKELDGRIIGVHPA 112 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 366 T S+G+ FVRF + + A+ M+G+ R +R Sbjct: 211 TGRSKGYGFVRFADESEQIRAMTEMNGQYCSSRPMR 246 >At3g09160.1 68416.m01082 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 198 Score = 29.1 bits (62), Expect = 2.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 194 DLRRVFERCGEVGDIYIPRDR 256 +L+++F CGE+ D++IP R Sbjct: 42 ELKKLFSPCGEITDVHIPETR 62 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +2 Query: 104 FKMSYGRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 F+M G + + V L + T + +RR FE+ GE+ + + D+ G+ Sbjct: 7 FQMEGGNNNTTDTKLTKIFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGR 61 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 29.1 bits (62), Expect = 2.6 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 113 SYGRPPPR--IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGKVE 274 S GRP P+ ++G + L V + T ED+ F GE+ ++ + DR G V+ Sbjct: 82 SDGRPGPQRSVEGWIIL-VSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVK 136 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 ++ S+G+AF+ + A AL M+G++++G + V +A Sbjct: 319 SKRSKGYAFLEYTTEEAAGTALKEMNGKIINGWMIVVDVA 358 >At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-like SR protein (SRZ22) identical to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352, 9G8-like SR protein [Arabidopsis thaliana] GI:3435094; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) and PF00098: Zinc knuckle; identical to cDNA 9G8-like SR protein (SRZ22) GI:3435093 Length = 200 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGR 342 R G+AF+ F + RDA +A+ +DG+ Sbjct: 35 RRPPGYAFLDFEDPRDARDAIRALDGK 61 >At3g53830.1 68416.m05947 regulator of chromosome condensation (RCC1) family protein / UVB-resistance protein-related contains Pfam PF00415 : Regulator of chromosome condensation (RCC1); similar to UVB-resistance protein UVR8 (GIi;10177674) [Arabidopsis thaliana] Length = 487 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = -1 Query: 502 KSDCGNGCGYDCASXYDGGNETWTCACDRNDSCMAMRGDHIAPSEREVPCRPTFVRPS 329 K CG GCG+ A G TW D S +A P +P V+ S Sbjct: 54 KDVCGGGCGFAMAISEKGKLITWGSTDDEGQSYVASGKHGETPEPFPLPTEAPVVQAS 111 >At1g75820.1 68414.m08807 CLAVATA1 receptor kinase (CLV1) identical to receptor kinase (CLV1) GB:AAB58929 GI:2160756 [Arabidopsis thaliana] Length = 980 Score = 28.3 bits (60), Expect = 4.6 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +2 Query: 119 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGKVEDS 280 G PP + G+VSLK +L+ ++ + F G + I + R+ G++ ++ Sbjct: 279 GHIPPELSGLVSLKSLDLSINQLTGEIPQSFINLGNITLINLFRNNLYGQIPEA 332 >At5g03480.1 68418.m00304 expressed protein ; expression supported by MPSS Length = 321 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 197 LRRVFERCGEVGDIYIPRD 253 L + F CGE+ IY+PRD Sbjct: 44 LTKHFASCGEITQIYVPRD 62 Score = 27.9 bits (59), Expect = 6.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 197 LRRVFERCGEVGDIYIPRDRTQG 265 L + F+ CGE+ +Y+P D +G Sbjct: 133 LEKHFDSCGEIRHVYVPTDYERG 155 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/38 (26%), Positives = 24/38 (63%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 +S+G+AFV F + A++A++ + + G+ +R ++ Sbjct: 155 DSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLS 192 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +2 Query: 152 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 247 +L V N+ T+ E L+ +F+R GEV I P Sbjct: 293 ALYVKNIPENTSTEQLKELFQRHGEVTKIVTP 324 >At3g61860.1 68416.m06947 arginine/serine-rich splicing factor RSP31 (RSP31) identical to SP|P92964 Arginine/serine-rich splicing factor RSP31 {Arabidopsis thaliana} Length = 264 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 274 GFAFVRFFERRDAEEALDTMD 336 G+AFV F + RDAE+A+ +D Sbjct: 36 GYAFVYFEDERDAEDAIRKLD 56 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +1 Query: 265 ESRGFAFVRFFERRDAEEALDTMDGRMLDGRELR 366 + +G+AFV F + A EA+DT++ G+ ++ Sbjct: 131 DGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIK 164 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 325 PGLLQHHDARKTLRRRILYFPLCTISGNVDITNFSAPFEN 206 PGLL H D K+L ++ F C I + DIT++ +N Sbjct: 437 PGLLIH-DGTKSLFLNLIAFEQCHIESSNDITSYIIFMDN 475 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 27.9 bits (59), Expect = 6.1 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRV 369 T++S+G AF+RF A+ A+ + M++G++ V Sbjct: 251 TKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGV 287 >At2g24590.1 68415.m02936 splicing factor, putative similar to to RSZp22 protein [Arabidopsis thaliana] gi|2582645|emb|CAA05352 Length = 196 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 262 RESRGFAFVRFFERRDAEEALDTMDGR 342 R G+AF+ F + RDA +A+ +DG+ Sbjct: 35 RRPPGYAFLDFEDSRDARDAIREVDGK 61 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +++GF FV F R+ A+EAL R+L+ R Q+A Sbjct: 141 TGKAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLA 179 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T +++GF FV F R+ A+EAL R+L+ R Q+A Sbjct: 141 TGKAKGFGFVMFKTRKGAKEALKEPKKRILN-RTATCQLA 179 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 119 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRT 259 GR I+ L + NL Y ED++ +F GE+ + DR+ Sbjct: 76 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRS 122 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 119 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRT 259 GR I+ L + NL Y ED++ +F GE+ + DR+ Sbjct: 12 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRS 58 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 119 GRPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRT 259 GR I+ L + NL Y ED++ +F GE+ + DR+ Sbjct: 78 GRSSAGIETGTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFDRS 124 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 259 TRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQMA 378 T+ S+GF FV F E A A + +DGR + ++A Sbjct: 46 TQRSKGFGFVTFREVESATRACEN-PNHTIDGRTVNCKLA 84 >At5g03500.1 68418.m00306 transcriptional co-activator-related low similarity to transcriptional co-activator CRSP33 [Homo sapiens] GI:4220890 Length = 443 Score = 27.5 bits (58), Expect = 8.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 197 LRRVFERCGEVGDIYIPRDRTQG 265 L + F CG++ IY+PRD +G Sbjct: 227 LEKHFASCGKITHIYVPRDFERG 249 >At4g22540.1 68417.m03253 oxysterol-binding family protein similar to SP|P16258 Oxysterol-binding protein 1 {Oryctolagus cuniculus}; contains Pfam profiles PF00169: PH domain, PF01237: Oxysterol-binding protein Length = 721 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 619 LSXXYXFTPIKDISVSES*AKKRLCEAG 536 L+ + F P KD+S+S KKRL E G Sbjct: 184 LNGDFSFIPPKDLSISTERLKKRLHEEG 211 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 155 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 L + +++ T E L+ F GEV + I +DRT G+ Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGR 45 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 155 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRTQGK 268 L + +++ T E L+ F GEV + I +DRT G+ Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGR 45 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 238 LHSQRSYTRESRGFAFVRFFERRDAEEALDTMDGRMLDGRELRVQM 375 L ++ T++ +GF F F A+ + R +DG+EL V + Sbjct: 233 LRAEDPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNV 278 >At1g07600.1 68414.m00813 metallothionein-like protein 1A (MT-1A) (MT-Q) (MT-2) identical to Metallothionein-like protein 1A (MT-1A) (MT-Q) (MT-2) SP:P43392 from (Arabidopsis thaliana) Length = 45 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = -1 Query: 505 AKSDCGNG----CGYDCASXYDGGNETWTCACDRNDSC 404 A S+CG G CG C+ + E C+C N SC Sbjct: 2 ADSNCGCGSSCKCGDSCSCEKNYNKECDNCSCGSNCSC 39 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,257,655 Number of Sequences: 28952 Number of extensions: 244356 Number of successful extensions: 881 Number of sequences better than 10.0: 150 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -