BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120789.seq (623 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 27 0.15 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 27.1 bits (57), Expect = 0.15 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -1 Query: 251 SFPLWLVVVAARIANLAFSCHATDVRCLLWFKSN*SVSQNIRYIIN 114 +FP+W V + AR+ L+ + RC + + VS N +++ Sbjct: 904 TFPVWQVTLNARLVELSLGSNPWSCRCKFLQELSSWVSDNAHKVVD 949 Score = 23.4 bits (48), Expect = 1.8 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -1 Query: 581 RLQHHDIFNRARGYNLSSPFVQTIQLAQSTKFVFQKSAFE 462 RL +DI N +RG P +Q + LA++ ++ AFE Sbjct: 484 RLIGNDIGNLSRGMLWDLPNLQILNLARNKVQHVERYAFE 523 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,820 Number of Sequences: 438 Number of extensions: 3779 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -