BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120788.seq (587 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47092| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_58206| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 >SB_47092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.5 bits (58), Expect = 8.6 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 271 KLPPFTRDNVLYYYIPMQGLASYTTLSVSVMNPHLMVRLFPQRDITD 411 K+PP + D ++Y ++ S L V + NPH+ + FP TD Sbjct: 373 KIPPDSID-IIYRQWQLKLALSSLILQVMLSNPHISIVFFPILIFTD 418 >SB_58206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 27.5 bits (58), Expect = 8.6 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -1 Query: 527 RDNHLKSPKKIDVQEQLPAMCGLAQSH 447 R +++++PKK+ +E A+ GLA+ H Sbjct: 421 RGDYIQAPKKVIDEEDFQAVSGLAKEH 447 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,678,439 Number of Sequences: 59808 Number of extensions: 328449 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -