BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120788.seq (587 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011056-1|AAR31127.1| 153|Drosophila melanogaster RE35907p pro... 83 4e-16 AE013599-1251|AAF58682.1| 153|Drosophila melanogaster CG13220-P... 83 4e-16 >BT011056-1|AAR31127.1| 153|Drosophila melanogaster RE35907p protein. Length = 153 Score = 82.6 bits (195), Expect = 4e-16 Identities = 32/70 (45%), Positives = 51/70 (72%) Frame = +1 Query: 262 NNIKLPPFTRDNVLYYYIPMQGLASYTTLSVSVMNPHLMVRLFPQRDITDVLFLSAGTGA 441 + + L PFTRDNV YYIP+ GL SY L+V+VMNP ++ ++ P++D+T+V +SA G+ Sbjct: 14 DKVGLKPFTRDNVFNYYIPLHGLVSYGALAVNVMNPQIVPKILPKKDLTNVFLISAVVGS 73 Query: 442 GLWLWARPHM 471 +++ RPH+ Sbjct: 74 AFYIYGRPHL 83 >AE013599-1251|AAF58682.1| 153|Drosophila melanogaster CG13220-PA protein. Length = 153 Score = 82.6 bits (195), Expect = 4e-16 Identities = 32/70 (45%), Positives = 51/70 (72%) Frame = +1 Query: 262 NNIKLPPFTRDNVLYYYIPMQGLASYTTLSVSVMNPHLMVRLFPQRDITDVLFLSAGTGA 441 + + L PFTRDNV YYIP+ GL SY L+V+VMNP ++ ++ P++D+T+V +SA G+ Sbjct: 14 DKVGLKPFTRDNVFNYYIPLHGLVSYGALAVNVMNPQIVPKILPKKDLTNVFLISAVVGS 73 Query: 442 GLWLWARPHM 471 +++ RPH+ Sbjct: 74 AFYIYGRPHL 83 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,244,092 Number of Sequences: 53049 Number of extensions: 479982 Number of successful extensions: 1008 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1008 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2358819486 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -