BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120788.seq (587 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z54235-1|CAA90971.1| 416|Caenorhabditis elegans Hypothetical pr... 47 9e-06 >Z54235-1|CAA90971.1| 416|Caenorhabditis elegans Hypothetical protein C09G9.1 protein. Length = 416 Score = 47.2 bits (107), Expect = 9e-06 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = +1 Query: 277 PPFTRDNVLYYYIPMQGLASYTTLSVSVMNPHLMVRLFPQRD--ITDVLFLSAGTGAGLW 450 PP T + L +Y+P G S+T +V + +P+++ LFP D +++ + +A G G + Sbjct: 29 PPVTSRSFLSHYLPASGALSHTLYTVHLFSPNIISSLFPTGDLAVSNTILFNANVGLGFY 88 Query: 451 LWARPHM 471 ++ R H+ Sbjct: 89 VYFRRHL 95 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,510,695 Number of Sequences: 27780 Number of extensions: 249501 Number of successful extensions: 573 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1237082886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -