BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120786.seq (589 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF039048-11|AAB94232.1| 421|Caenorhabditis elegans Hypothetical... 31 0.80 L25598-1|AAA27942.1| 129|Caenorhabditis elegans Hypothetical pr... 29 3.2 >AF039048-11|AAB94232.1| 421|Caenorhabditis elegans Hypothetical protein F16B4.1 protein. Length = 421 Score = 30.7 bits (66), Expect = 0.80 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 101 YRCRANAAHHSRCFFFAEPRGECRFSR 181 + CRA AA RC F E R CR S+ Sbjct: 49 FSCRACAAFFRRCHFLKENRRRCRLSK 75 >L25598-1|AAA27942.1| 129|Caenorhabditis elegans Hypothetical protein C06G4.4 protein. Length = 129 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +3 Query: 51 VTKPPKKSEKLQQYKKAIAAEQTLRTTADVSSLQNHGESAV 173 +++ PK+SEK YKKA+A ++ ++ + G+ V Sbjct: 1 MSEAPKRSEKSADYKKAVAKQRRIKKLRKMKIKDRAGDVVV 41 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,924,888 Number of Sequences: 27780 Number of extensions: 212045 Number of successful extensions: 503 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1237082886 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -